(data stored in ACNUC7421 zone)

EMBL: AP011115.PE442

AP011115.PE442       Location/Qualifiers
FT   CDS_pept        complement(452661..453962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48689"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL2"
FT                   /protein_id="BAH48689.1"
FT                   /translation="MAEIRVSASEVRLALSRFERFAGLHGNVAVPMPLIRGAEVIADPF
FT                   ANIRGVRAPGLGIPRRLCIGTWRGRGVRSFVAARAGVPAIRVRTLGRGAGAEFDELIVT
FT                   VSDPGHVVAQIRDVLDPGRVRAVEREVRFRSGDGTLLAGTATVPAGAEGGPAAVILTGS
FT                   GRLDRDGDHAKLPIGVSRALADALARAGVASLRYDKRGVARSGGDYLSTGLSDNIADAA
FT                   AAVDWLRTTGGFGRSSIAVIGHSEGACLAVALGADRGVDPAAVVLLACPAVTGRQVLQW
FT                   QSGEAVDGLPSAVRVVLRALRIDVKERQRVALEKLSRTTTDAARMGGRRVNARWFREFL
FT                   DFDPKPLLRENLAPVLVITGAKDVQVDPEDLAVIAELVPGGADTVQVPDLTHLIRRDAD
FT                   PPSLRAYRRLVRDAVDPEVLSLVADWTAGHLRRV"
     atggccgaga tccgtgtcag cgcgagcgag gtgcgtctcg ctctgtccag gttcgagagg        60
     ttcgccggac tgcacgggaa cgtcgcggtg cccatgccgc tgattcgggg cgccgaggtg       120
     atcgccgacc cgttcgcgaa catccggggt gtgcgggcac cgggtctggg aattccgcgg       180
     cgtctgtgca tcgggacctg gcggggcagg ggagtgcgct ccttcgtcgc agcgcgggcg       240
     ggtgtcccgg cgatccgcgt gcgcacgctc ggccggggtg cgggagcgga gttcgacgaa       300
     ctgattgtga ccgtgtccga tcccggtcac gtcgtggcgc agatccgtga cgtgctcgat       360
     cccgggcgag tgcgagcagt cgaacgcgag gtgaggttcc ggtccggcga cggcacccta       420
     ctggccggca ccgcgacggt tccggcgggt gccgagggtg gtccggcggc ggtgatcctc       480
     accgggtccg gccggctcga ccgcgacggc gaccacgcga agctcccgat cggcgtgagc       540
     cgtgccctcg cggacgcgtt ggcccgggcc ggtgtcgcgt cgctgcgata cgacaagcgc       600
     ggagtcgcac gctcgggcgg cgattacctg tcgacgggtc tgtcggacaa catcgccgac       660
     gccgctgccg ccgtcgactg gttgcgcacg acaggaggat tcggacgaag ttcgatcgcg       720
     gtcatcgggc acagcgaggg tgcctgcctg gcagtggcgc tgggagcgga tcgcggggtc       780
     gacccggcgg cagtggtgct cctcgcgtgt ccggcggtga cggggcggca ggttctgcaa       840
     tggcagtccg gcgaggccgt cgacggtctg ccctctgcgg tacgggtagt cctgcgggcg       900
     ctgcgaatcg acgtgaagga aaggcagcgc gtcgcgctcg agaagctgtc ccggaccacc       960
     actgatgcag cgcggatggg tggtcgccgg gtgaatgcgc gctggttccg ggagttcctc      1020
     gacttcgacc cgaaaccgct gttgcgggag aacctcgcgc cggtcctcgt gatcaccggg      1080
     gcaaaggatg tccaggtgga tccggaggat ctcgcggtga ttgcggaact ggtgcccggc      1140
     ggggccgaca ccgtccaggt tccggacctg acgcacctga tccgacgtga tgcggatccg      1200
     ccgtcgttgc gcgcctatcg ccgactcgtg cgcgacgccg tggatccgga ggtgctgtcg      1260
     ctggtggccg actggacggc cggccacctg cgccgtgtct ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page