(data stored in ACNUC7421 zone)

EMBL: AP011115.PE443

AP011115.PE443       Location/Qualifiers
FT   CDS_pept        complement(454130..454615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48690"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL3"
FT                   /protein_id="BAH48690.1"
FT                   /translation="MPVTNVSQDTDALTLTITAEFAAPRARIWQIYADPRQLEKVWGPP
FT                   TYPATVVDHEFAAGGRVTYFMTGPEGEKYAGYWNIISVDEPTGFTFTDGFADADFTPIE
FT                   SMPVSTNEFSFAEKDGSTVATYVSTYATAEGLQKVLDMGVVEGSSQAIGQIDDLIKG"
     atgcctgtca cgaacgtcag ccaagacacc gatgcattga ctctgaccat cactgccgag        60
     ttcgccgcac cccgggcgcg gatctggcag atctatgccg atccccgcca gctcgagaag       120
     gtgtggggcc cgccgacgta cccggcgacc gtcgtcgacc acgagttcgc cgcgggcggt       180
     cgcgtcactt acttcatgac cggccccgaa ggcgagaagt atgcgggcta ctggaacatc       240
     atctccgtcg acgagccgac cgggttcacc ttcaccgacg gattcgccga tgcggacttc       300
     actccgatcg aatcgatgcc ggtgtccacc aacgagttct ccttcgcgga gaaggacggc       360
     agtaccgtcg ccacctacgt cagcacctac gcgacagccg aaggtctcca gaaggtgctc       420
     gacatgggcg tggtcgaggg ttcctcgcag gcgatcggcc agatcgacga ccttatcaag       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page