(data stored in ACNUC7421 zone)

EMBL: AP011115.PE445

AP011115.PE445       Location/Qualifiers
FT   CDS_pept        complement(455356..455670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48692"
FT                   /db_xref="GOA:C1ARL5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL5"
FT                   /protein_id="BAH48692.1"
FT                   /translation="MRRASSGVEGNGMFGTGLGAMVGLLVVALLVVPVSFGVAARADAK
FT                   ARRLSESPASDANEGLSVAVAEMTGRCDQWRQLATQAWLICGGASLVAVVVVGVLICVG
FT                   "
     atgcgacggg cgtcgtccgg tgtggaagga aatggaatgt tcgggacggg tttgggtgcg        60
     atggtgggcc tgctggtggt tgcgctgctg gtggtccccg tgtcgttcgg tgtggcggcg       120
     cgcgcggacg cgaaggcccg ccggctttcg gagtcacccg cgtccgatgc gaatgagggg       180
     ctatctgtcg cggtcgcgga aatgaccggg cggtgcgatc agtggcgtca actcgcgact       240
     caggcgtggc tgatctgcgg cggcgcctcg ctggtcgcgg tggtggtcgt gggtgtgctg       300
     atctgcgtgg ggtga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page