(data stored in ACNUC7421 zone)

EMBL: AP011115.PE452

AP011115.PE452       Location/Qualifiers
FT   CDS_pept        461290..461877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48699"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM2"
FT                   /protein_id="BAH48699.1"
FT                   /translation="MRAGFPDFRLGNVLATSFTGTLSERHGNAVERIPTPHRLVDWLAA
FT                   NGLVVDFCTTTQLELARELRESIHAASTAVASQDDLPASAVRVINDCSIRGRAAAILTP
FT                   EGNRRWRLSSPSCVEDALGVIAADAISIIAGERDGKFALCASPTCRAAFFDTSQSRTRK
FT                   WCDMNTCGNRQKKARFNANHRKNPDAPRAPRI"
     atgcgcgccg gtttccccga ctttcgcctc ggtaacgtgc tcgcgaccag cttcaccgga        60
     accctgtcgg agcgtcatgg caacgctgtg gagcgcattc ccacgccgca ccgactcgtc       120
     gactggctgg cagcgaacgg actcgttgtg gacttctgca ccaccaccca actcgaactc       180
     gcgcgggaac tgagggaatc aattcatgcg gcctcgacag cggtcgcgag ccaagacgat       240
     ctccctgcgt ctgccgtccg agtcatcaat gactgcagca ttcggggtcg ggccgccgcc       300
     atcctgacgc cggagggcaa tcggcgatgg cgactcagct cgccttcctg tgtggaagac       360
     gccctgggcg taatcgcagc cgacgccatc agcatcatcg caggcgaacg cgacggaaaa       420
     ttcgccctgt gcgcttcgcc cacgtgccga gccgccttct tcgacaccag ccaaagtcgc       480
     actcgcaaat ggtgcgacat gaacacctgc gggaatcgtc agaagaaggc gcgcttcaat       540
     gccaaccatc gcaagaaccc cgacgctcca cgcgctccca ggatctga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page