(data stored in ACNUC7421 zone)

EMBL: AP011115.PE457

AP011115.PE457       Location/Qualifiers
FT   CDS_pept        466296..466913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48704"
FT                   /db_xref="GOA:C1ARM7"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM7"
FT                   /protein_id="BAH48704.1"
FT                   /translation="MDGPVARAFDSAARRFLEVSAAATGHYDAPGLGEWSVRDLVGHTS
FT                   RSLSTVETYLDAAGEDPGAVELTDAVAYYLAIADALSDTAAVAQRGREAGAALGEDPMG
FT                   ALSALVARVPERVRASPSTALVRTPFGTMTLQGYLPTRTLELTVHTCDLAAALGVDADV
FT                   PREAVAETFAVIGGLAAVQGTAPAALLALTGRSPLPAGYSVL"
     atggacggtc cagttgctcg cgccttcgac agcgccgcca gacggttcct cgaagtgagt        60
     gccgccgcga caggccacta tgacgcaccc ggcctcggtg agtggtccgt gcgcgacctg       120
     gtcgggcaca ccagccggtc gctgtcgacg gtcgagacat acctcgacgc cgccggcgag       180
     gaccccggcg ctgtagagct gaccgacgcc gtcgcgtact acctggccat cgccgacgcc       240
     ctgtccgaca ccgcagcggt ggcgcagcgg ggacgcgaag ccggcgccgc gctcggcgag       300
     gacccgatgg gtgccctgag cgcactggtt gcccgggtgc ccgagcgggt ccgggccagt       360
     ccgtccactg ccctggtgcg cacacccttc gggacgatga ccttgcaggg ctacctcccg       420
     acccgaaccc tcgagctgac cgtacacact tgcgacttgg cagccgccct cggcgtcgac       480
     gccgatgtcc cccgcgaggc agtagccgag acgttcgccg tcatcggtgg cttggccgca       540
     gtgcagggaa cagcacccgc agcgctgctg gcgttgaccg gccgctctcc cctgcccgcc       600
     ggttactcgg tcctctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page