(data stored in ACNUC7421 zone)

EMBL: AP011115.PE458

AP011115.PE458       Location/Qualifiers
FT   CDS_pept        complement(466983..467465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48705"
FT                   /db_xref="GOA:C1ARM8"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM8"
FT                   /protein_id="BAH48705.1"
FT                   /translation="MEIVVRAAVLFLFLWVITRVVGRSTVGELSTFQLVLYVVMGDLVQ
FT                   QGVTQQDYSVTSAVLAVGVFALLTLALAWANARFPRVRGVTHGVPVIIVRDGIPDLDRL
FT                   RTERMSLDDLMADARQKGIRRFDEIELAVLETNGRVSFFTRTGHTDAGAPEQPGIA"
     atggagatcg tggtccgggc ggcggtcctg ttcctgttcc tgtgggtgat cactcgcgtc        60
     gtcggacggt cgaccgtcgg tgaactgagt acgtttcaac tggttctgta tgtcgtcatg       120
     ggtgacctcg tgcagcaggg tgtgactcag caggactact cggtcacctc cgcggtcctc       180
     gcggtcggag ttttcgccct gctcaccctg gcactcgcct gggccaatgc ccggtttccg       240
     cgcgtgcgcg gagtgacgca cggtgtgccg gtcatcatcg tgcgtgacgg catccccgac       300
     ctggaccgtc tccgcaccga acgaatgtcg ctcgacgact tgatggccga cgcacggcag       360
     aagggtatcc gtcgattcga cgagatcgag cttgctgtgc tcgaaaccaa cggtcgcgtg       420
     tcgttcttca cccgcaccgg ccacacggac gctggggcgc cggaacagcc gggcatcgcg       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page