(data stored in ACNUC7421 zone)

EMBL: AP011115.PE459

AP011115.PE459       Location/Qualifiers
FT   CDS_pept        complement(467465..467995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48706"
FT                   /db_xref="GOA:C1ARM9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM9"
FT                   /protein_id="BAH48706.1"
FT                   /translation="MRPSDRIPASVFDDVREYARTPAVAWLRRAAVALLALIVAFGAVG
FT                   LLGVRSGTAYAEGGGYALTLTYPRVARAGLDVPWDLTVRKPGGFSEPVVIVVDSDYFDM
FT                   FETQGWTPEPSAETSDALRTYMTVDPPPGDTLTLGFDAYIQPSSQLGHSGSVSVSEKGV
FT                   DVATLEFTTWLVP"
     atgcgtccct ccgaccgcat tccggcttca gtgttcgacg acgtgcgcga atacgcacgg        60
     acgccggccg tcgcttggct ccgacgagcg gctgtcgcgc tgctcgccct gatcgttgcg       120
     ttcggcgcgg tcggtctcct cggtgtccgg agcggcaccg cctacgctga gggaggcgga       180
     tatgcgctga ctctcacgta cccgagggtg gcgcgcgcgg gactggacgt gccgtgggac       240
     ctgacggtcc ggaaaccggg cggcttctcg gagccggtgg tgatcgtcgt cgattccgac       300
     tacttcgaca tgttcgagac ccagggctgg acaccggagc cgtccgcaga gaccagcgat       360
     gccttgcgta cctacatgac cgtcgatcca ccgcccgggg acaccctcac cctgggtttc       420
     gacgcctaca ttcagccgtc gagtcagctc ggccattcgg gatcggtgtc ggtgtccgag       480
     aagggagtcg atgtggccac cctggagttc accacctggc tggtgccctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page