(data stored in ACNUC7421 zone)

EMBL: AP011115.PE460

AP011115.PE460       Location/Qualifiers
FT   CDS_pept        complement(468621..468992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48707"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN0"
FT                   /protein_id="BAH48707.1"
FT                   /translation="MWRNAHVPSYLLGMPPRYHVTSVLNRASIFRYGLDFSRMGAARGI
FT                   AGSSGPEQKGCFLAADEWERDWFVRMNNTGGAVDVWEVHGINDDDLIESPEGHYFFPGV
FT                   IAAAKLRLVQRDLPPSRNY"
     gtgtggcgaa acgcgcatgt tcctagttac cttttgggaa tgccaccccg ctaccacgtc        60
     acctcggtgt tgaaccgcgc atccattttc cgatacgggt tggacttcag tcggatgggt       120
     gctgctcgcg ggatcgcagg gagcagtggc cccgagcaga agggctgctt cctcgctgcc       180
     gacgagtggg aacgcgattg gttcgtgagg atgaacaata cgggcggagc ggtggacgta       240
     tgggaggtcc acggcatcaa cgatgacgat ctcatcgagt cacccgaggg ccactacttc       300
     ttccctggcg taatcgcagc ggccaaattg cggttggtgc aacgcgatct accgccgtcc       360
     cggaattact ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page