(data stored in ACNUC7421 zone)

EMBL: AP011115.PE462

AP011115.PE462       Location/Qualifiers
FT   CDS_pept        469686..469955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48709"
FT                   /db_xref="GOA:C1ARN2"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN2"
FT                   /protein_id="BAH48709.1"
FT                   /translation="MATKDSQPQLKDQEMYEELREMGDSKEKAARISNAAAARGRKNVG
FT                   KSGGKSQSYDDWTVDELEKRAKELGLKGYSKLNKKELIDELRNH"
     atggcaacca aggattcaca gccccaactc aaagaccagg agatgtacga ggaactacgc        60
     gaaatgggcg attccaagga gaaggcggcg cgcatctcca acgcggccgc cgcgcgtggc       120
     cgcaagaatg tcggaaagtc gggcggaaag tcgcagtcct acgacgactg gacggtcgac       180
     gagctcgaga agcgagccaa agaactggga ttgaagggtt actcgaaact gaacaagaaa       240
     gaactcatcg acgagctccg caatcactga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page