(data stored in ACNUC7421 zone)

EMBL: AP011115.PE463

AP011115.PE463       Location/Qualifiers
FT   CDS_pept        470033..470398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN3"
FT                   /protein_id="BAH48710.1"
FT                   /translation="MQKVLTFAAGAAVGFVLGTRSGRQTYEKMRHQSLELWHNPTVQEK
FT                   VSEATDTVKDKAPQVQHKVGELAKKATHRHTDTHSTTAPTNGASLGDAPTPPPAAPTPT
FT                   DAETTTGVPPTRGESAG"
     atgcagaaag tgttgacctt cgcagcgggc gccgccgtgg gcttcgtcct tggcacccga        60
     tccggcaggc agacctacga gaagatgagg catcagtccc tcgaactatg gcacaacccc       120
     accgtgcagg agaaggtgag cgaggcgacg gacaccgtga aggacaaggc gccacaggtg       180
     cagcacaagg tcggtgaact ggcgaagaag gcaacccacc gccataccga cacgcactcg       240
     acgacggccc ccaccaacgg agcgtcgctg ggtgatgctc cgaccccgcc tccggcggcc       300
     ccgactccca cggacgcgga aaccacgacc ggtgttccgc cgacgcgcgg cgaatctgcc       360
     gggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page