(data stored in ACNUC7421 zone)

EMBL: AP011115.PE464

AP011115.PE464       Location/Qualifiers
FT   CDS_pept        complement(470435..470932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48711"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN4"
FT                   /protein_id="BAH48711.1"
FT                   /translation="MGTRTPWHPVPHHPGVLPSAPLCARRCGAGSDSAYAKYPQSIDAV
FT                   AAEYRLTGTRGADFWGNSVTSTADTVTFLEAKTTDPSSPILGWMATAAPVAVDGTRQNG
FT                   GTGALPSVTGTKWGWSDDGSSVVASASFGPDFSVAANTYGTAEQHTSDVLGAFGLEPTP
FT                   PA"
     atgggtacac ggacaccatg gcatccagtt ccgcatcacc ccggtgtcct cccgtccgcg        60
     cccctgtgtg ccaggcgatg cggagcagga tccgattcgg cgtatgcgaa atatccgcaa       120
     tccatcgacg ccgtcgccgc cgagtaccgg ctcaccggca cccgcggcgc ggacttctgg       180
     ggcaactcgg tgaccagcac ggccgacacg gtcaccttcc tcgaagcgaa gaccaccgac       240
     ccgagcagcc ccattctcgg atggatggcc accgccgccc ccgtcgccgt cgacggcacc       300
     cgccagaacg ggggcaccgg cgcactgccc tccgtcaccg gaaccaaatg gggatggtcc       360
     gacgacggct ccagcgtcgt tgcctccgca tctttcggac ccgatttttc ggtcgccgcc       420
     aacacctacg gcaccgccga acaacacacc agcgacgtcc tcggcgcgtt cggcctcgaa       480
     cctaccccgc ccgcctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page