(data stored in ACNUC7421 zone)

EMBL: AP011115.PE465

AP011115.PE465       Location/Qualifiers
FT   CDS_pept        complement(470944..472236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48712"
FT                   /db_xref="GOA:C1ARN5"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN5"
FT                   /protein_id="BAH48712.1"
FT                   /translation="MTRKDRDRLSADDAHILGLESAVISGHTLKLVVLAPAPGPLDIEA
FT                   LRTAVAERLSSQPRATERIDTSGAQPRWTAATAFDICDHVRRREEAGCTSRADLWRAVS
FT                   TLMSEHLDHERPLWTFDLIGPLGDGREAIAVRIHHAMADGIGAVRFLDDVLWDRHADPA
FT                   PRESRPGVRAESTKHSRIDEVLRMPAAMRRELGHRGSRSPFDRPISAARELAFTVAPLS
FT                   ELKAIGASRPTRATVNDVLLGIVAGGLRSWLSTGDAALPRLRAQVPVSLHHRNEEARVG
FT                   NRDSFLNIDLPLAEADPLIRLDRISAETSKRKHLDDADELFDLFHALGRVKGVGAAAQR
FT                   LAGSAREFSLAISNVPGPPLPVSVSGRRVERLFSSSEPAVHHALRISAISCAGIVGIGL
FT                   CTDPEALPDVARLAMAMEDSYTELRDATSTP"
     gtgacccgca aggatcgtga tcggctttcc gccgacgatg cgcatatcct ggggctcgaa        60
     tcggcggtga tatccggcca cacgctgaag ctggtggttc tcgcgccggc acccggcccg       120
     ctcgacatcg aggccctgcg aaccgcggtg gcggagcgcc tttcgagcca gccccgcgcg       180
     acggagcgaa tcgacacctc gggtgcacag ccgcgctgga ccgcggcgac cgccttcgac       240
     atctgcgacc acgtccggcg ccgggaagaa gccggctgca cgtcgcgggc cgatctgtgg       300
     cgagccgtca gcacgctgat gtccgagcat ctcgaccacg agcgtccact gtggacgttc       360
     gacctgatcg gcccactcgg cgacggacgc gaggcgatcg cggtccgcat ccatcacgcg       420
     atggccgacg gaatcggcgc ggtgcggttc ctggacgacg tgctctggga tcggcacgcc       480
     gacccggcac cgcgcgagtc gcgtcccggt gttcgcgccg aatcgacaaa gcattcgagg       540
     atcgacgagg tgctgcggat gccggcggcc atgcgtcgtg agctcggaca ccgcggctca       600
     cgctcgccct tcgaccgtcc gatcagtgcc gcccgcgagc tcgcgttcac cgtcgccccg       660
     ctctcggaac tgaaggcaat aggcgcctcg cgccccaccc gcgcaaccgt caacgacgta       720
     ctgctgggga tcgtcgccgg tggcctgcgc agctggctct cgaccggcga cgccgcgctg       780
     ccgcgtcttc gcgctcaggt tccggtcagc cttcaccacc ggaatgagga agcgagagtc       840
     ggaaatcgcg attccttcct gaacatcgat ctgccgctcg ccgaggccga tccgctcatc       900
     cgactcgacc ggatcagcgc cgagaccagc aagcgcaagc acctcgacga cgcagacgag       960
     ctcttcgatc tcttccacgc cctcggacgc gtgaagggcg tcggggcggc tgcacaacgg      1020
     ctcgccggga gcgcgcgcga gttcagcctt gcgatctcga acgtccccgg cccgcccctg      1080
     ccggtgagcg tgtccggacg tcgggtggag cggcttttct cctcctcgga gcctgccgtt      1140
     caccacgcgc tgcggatctc ggcgatttcg tgcgccggga tcgtcggtat cgggctctgc      1200
     accgaccccg aggcactgcc tgatgttgcc cggctggcga tggcgatgga agattcgtac      1260
     accgaattgc gggacgccac atcgacgcct tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page