(data stored in ACNUC7421 zone)

EMBL: AP011115.PE467

AP011115.PE467       Location/Qualifiers
FT   CDS_pept        473194..474144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48714"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN7"
FT                   /protein_id="BAH48714.1"
FT                   /translation="MSDLHPRKMDFAFDEQDVPFLWNPDNPAWSSMSNAISFLAIGFEK
FT                   MIVKAIMQAKPLMTDPEVAEEAVAFMRQEGHHSTAHRQHVKALIRRYPGLQNTLDAVIG
FT                   EYDLLTEATSLNYRLAYTADLEATFTPVFKLMLDNDATLFRPGDDRVASLFIWHFVEEV
FT                   EHRSSALVIFDSLVGEELYRMRMAPSIFTHVMKVVRIACAGFNQHVPLRERKVDAMSMF
FT                   ATHRTKQKLLTAFAPYLSKGIMPRAFDHLPRGEQLTALAGVVRSQMPKHNPTHEKLPAL
FT                   ADEWFTRYDAGFDCTRWYTAESSEQRTEPAPAVVN"
     atgtccgacc tgcatcccag aaagatggat ttcgcgttcg acgagcagga cgtcccgttc        60
     ctctggaacc ccgacaaccc cgcctggtcg agcatgtcca acgcgatctc gttcctggcc       120
     atcggtttcg agaagatgat cgtcaaggcg atcatgcagg ccaaaccact gatgaccgat       180
     cccgaggtcg cggaggaggc cgtggcgttc atgcgtcagg agggccacca ctcgaccgcg       240
     caccgccagc acgtcaaggc cctgatcagg cgttatccgg gacttcagaa taccctcgac       300
     gcggtgatcg gcgagtacga cctcctcacg gaggcgacaa gtctgaacta ccgactcgcc       360
     tacaccgccg acctggaggc gacgttcacg ccggtgttca agctgatgct cgacaacgac       420
     gcgaccctct tccggccggg cgacgaccgg gttgcatccc tgttcatctg gcacttcgtc       480
     gaggaggtcg aacatcgaag ttcagcgctg gtgatcttcg attcccttgt cggagaggag       540
     ctgtaccgga tgaggatggc gccgtcgatc ttcacgcacg tgatgaaggt ggtccggatc       600
     gcgtgcgccg ggttcaacca gcacgtccca ctcagggagc ggaaggtcga tgcgatgtcg       660
     atgttcgcga cgcaccgcac caagcagaag ctgctcaccg cattcgcgcc atacctgagc       720
     aaagggatca tgccccgcgc gttcgaccac ctcccccgcg gcgaacaact caccgccctc       780
     gccggcgtcg tccgtagtca gatgccgaag cacaacccga cgcacgagaa gctgcccgcg       840
     ctcgccgacg agtggttcac gcgatacgac gcaggcttcg actgcacccg ctggtacacc       900
     gccgagtcga gtgagcaacg gaccgagccc gccccggcgg tggtcaactg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page