(data stored in ACNUC7421 zone)

EMBL: AP011115.PE468

AP011115.PE468       Location/Qualifiers
FT   CDS_pept        474144..475301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48715"
FT                   /db_xref="GOA:C1ARN8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN8"
FT                   /protein_id="BAH48715.1"
FT                   /translation="MADLCSPTFDQLSTALGFSCAEAGGLVEVRSPLALENWTLPVLEL
FT                   TIVLGSVLALVFAVLRWRRNGDPTTLALWFGATAYLFVIEPPLYFPAAFGIEEHVDTMF
FT                   AHNVFTVDFLWGRLPLYIIAIYPLMATLAFELVRMLGVFRKYGVLVGAVCVGFVHHAFY
FT                   EIFDQLGPQLRWWEWSTTNPVNQPMFDAVPLPSVVVFAALWPMSLAMCVQFFVGRHADR
FT                   GRKFTGLELAWRTIVIGLLASAGTFILPLPATVLGMESTTVRGVFYAAELAVVALVAIP
FT                   VLVRQWSRLRGGTSDVPSYSNDFVRAYSVVYLGVMGMLWLTALPDYFAAVDGVTSNGDP
FT                   IGNIWYTIVCFAIAVLCVAATFTVPRNSVNGHGAVSGERTPDAVR"
     atggccgatc tctgctcacc caccttcgat cagctgtcga cggcgctcgg cttctcgtgc        60
     gccgaggccg gtggactcgt cgaggttcgc agtccgcttg ccctggaaaa ctggaccctt       120
     ccggttctgg agctcacgat cgtgctcggg tcggtgctcg ccctcgtgtt cgcggtcctg       180
     cgctggcgcc gcaacggcga tccgaccacc ctggcgctct ggttcggcgc caccgcgtat       240
     ctgttcgtca tcgaaccgcc gctgtacttt ccggcggcgt tcgggatcga ggaacacgtg       300
     gacaccatgt tcgcgcacaa cgtgttcaca gtcgactttc tgtggggccg gctgcccctg       360
     tacatcatcg cgatctaccc actgatggcc acgctggcct tcgaactcgt ccggatgctc       420
     ggcgtattcc gaaagtacgg cgtgctcgtc ggcgcggtct gcgtgggctt cgtgcaccac       480
     gcgttctacg agatcttcga ccaactcggg ccgcagctga ggtggtggga atggtcgacc       540
     accaaccccg tcaaccagcc catgttcgat gcggtcccgc taccgagcgt cgtggtgttc       600
     gcggcactgt ggccgatgtc gctggcgatg tgcgtccaat tctttgtggg ccgccacgcc       660
     gaccggggcc ggaagttcac cgggctcgaa ctggcctggc ggacaatcgt aatcggcctc       720
     ctggcgtcgg caggcacgtt catcctcccc ctccccgcca cggtcctcgg gatggagagc       780
     accacggtcc ggggagtctt ctacgcggcg gaactggccg tcgtcgcgct cgtcgcgatc       840
     ccggtcctgg tgcggcagtg gtcgcggctg cgcgggggga cgtcggacgt tccgtcctac       900
     tcgaacgact tcgtccgtgc ctacagcgtg gtgtacctcg gcgtgatggg catgctgtgg       960
     ctgaccgcgt taccagacta cttcgctgcc gtcgacggtg tcacgagcaa cggcgatccc      1020
     atcggaaaca tctggtacac gatcgtctgc ttcgcgatcg cagttctgtg cgtcgccgcc      1080
     accttcacgg tgccgcggaa ttccgtgaac ggacacggcg cggtctccgg agaaaggacg      1140
     ccagacgctg tccgatag                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page