(data stored in ACNUC7421 zone)

EMBL: AP011115.PE469

AP011115.PE469       Location/Qualifiers
FT   CDS_pept        complement(475911..479861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04690"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48716"
FT                   /db_xref="GOA:C1ARN9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN9"
FT                   /protein_id="BAH48716.1"
FT                   /translation="MEHAARATYREHRSDPFPLSAAQHGLWFAQQLAPDVPICIAQYVD
FT                   IRGPLDVELFREVALVAGHEYESVFLRLIDVDGEPHQVIDPPADAAMGVVDFRGASDPM
FT                   AAAETWMHDNYTARVDFEHDHLCESSLLCVGDERHLWYSRIHHVALDGYAAMTLVNRVA
FT                   ALYTAAVEDRALEPNRAADLHTLHRLEEDYRASHRFTSDRDYWAERLHRRTNGASLTDV
FT                   EAPPAAHSLTVRAALSPDTVARLEDTGGRPGATAAAALIAAFACHLSRRTGQEEVLVDI
FT                   PLSARTTAVLRRSSGMLANVAPLLVQVRSGDTVGDLVARVQHELMGAMRHQRGNVEDIL
FT                   RDLGVSAESRRISGPMVNVMLFDQDLTFGSLTGDFRILTTGPVPDLSVNVYRSGTPAST
FT                   IVEFEANPYRYREDELRSHHAAVVGLIDDVLAADPDTPLAAIGVADVGRLTPVVGGLSV
FT                   SEVSLPELLAAAVAVDPDAVAVVCEGRGLSYRELDEASNRLARVLLGSGVGCESVVAVA
FT                   VGRSVESVLSVWAVAKTGAAFVPVDPGYPVGRIEHMVADSGVVVGVTLSGSVAVLPGGV
FT                   RWVVLDDVETVEWLSSVSAGPVTDGDRGAPVRVGQAAYVIYTSGSTGLPKGVVVSHRGL
FT                   ANVVASQRAGFGGGVGARVLQCASPSFDASVFELVWAVGLGGRLVVVPPTVYGGEELAR
FT                   ILVSEGVTHAVLTPTALSSLDPSGLEALGALVVAGEVCPPELVARWAPGRSMFNAYGPT
FT                   ESTIMSNASDGLVVGESVTIGGPVRGFGELVLDARLRPVPVGAVGELYLSGPGLARGYR
FT                   NRVGLTSARFVADPFGVPGQRMYRTGDVVRWREGAGGGLVLEYVGRADFQVKIRGFRVE
FT                   LGEIESALLGYPGIDHAVVHTSGDRLAGYVVPVAGSDLDTSAVLAHARTRLAPHMVPAT
FT                   VTVLDAVPVTANGKLDRAALPEPDFTAGRAEYRAPRNATEEMVAAAFAGGLGLDRVGLD
FT                   DNYFALGGTSLTATSVIARIAEDAARAVPVQWIFTHPTPEALAHMIATAPEDARAGDTA
FT                   DRSLDVLLPLRTTGTGSPVFCIHPAIGLAWCFTGLVQYLGDRPVYGLQSPALTDPDLRI
FT                   DSLQELAGRYVDRIRSVQPHGPYHLVGYSVGGQIAHEMAVQLTGAGDEVATLTMLDTHL
FT                   AGGLDRTAEKPTMAALLAEFGAVVPRDGDDATTTERAVEVLRRTGGPFAAVTADDLDAV
FT                   HRVFTQTVDLALAHRPSTPSGVDLLYFGAADSVDAPTGVSAWRQHITGEILVHHVPAAH
FT                   QQMTSPEALAGIGPVLAHHVLLADKPMRVVSS"
     atggaacacg ccgcacgagc gacctaccgt gagcatcgat cggatccgtt tccgctgtct        60
     gcggcacaac acgggctgtg gttcgcacag caactcgccc cggacgtgcc gatctgcatc       120
     gcgcagtacg tcgacattcg tgggccgctg gacgtcgaat tgttccggga ggtcgcgctc       180
     gtggccggcc acgaatacga gtcggtgttc ctgcggctga tcgacgtcga cggggaacca       240
     caccaggtga tcgatccgcc cgccgacgcg gccatgggcg tcgtcgactt tcgcggcgca       300
     tccgacccga tggcggcagc agagacgtgg atgcacgaca actacacggc gcgagtagat       360
     ttcgaacacg accacctgtg cgagtcgtcc ctgctgtgcg tcggtgacga gcggcacctg       420
     tggtacagcc ggatccacca cgtcgccctc gacggatacg cggcgatgac actggtcaac       480
     cgcgtcgccg ccctgtacac cgccgcggtc gaagaccgtg ctctcgaacc gaaccgtgcc       540
     gcggacctgc acaccctgca ccgactcgaa gaggactacc gggcatccca ccggttcacg       600
     tccgaccgcg actactgggc cgaacgactc cacaggcgca cgaacggggc ctccctgacc       660
     gatgtggagg cgccccccgc cgcccacagc ctcaccgtgc gcgcggcgtt gtctcccgat       720
     accgtcgctc ggctcgagga caccggcggc cggccgggcg cgacggcggc cgccgctctg       780
     atcgccgcct tcgcctgcca tctctcacgg cggacgggac aggaagaagt cctcgtggac       840
     attcccctat ctgcccgcac caccgcagta ctgcgacggt ccagcggcat gctcgccaac       900
     gtcgcccccc tgctggtgca ggtccgatcg ggcgacacgg tcggcgacct cgtggcccgg       960
     gtgcagcacg aactgatggg agcgatgcgg caccagcgcg gcaatgtgga ggacatcctg      1020
     cgtgacctgg gtgtgtccgc cgaatcccgc aggatctcgg gaccgatggt caacgtgatg      1080
     ctgttcgatc aggacctcac gttcgggtcg ctgaccggag acttccggat cctcaccacc      1140
     ggccccgtcc cggacctgtc cgtcaacgtg taccgcagcg gcaccccggc atcgacgatc      1200
     gtcgagttcg aggccaaccc gtaccgctac cgcgaggacg aactgcggtc gcatcacgcc      1260
     gcagtcgtcg ggttgatcga cgacgtgctc gccgcagacc ccgacactcc actcgccgcg      1320
     atcggtgtgg cggatgtggg tcggttgacg ccggtggtgg gtgggttgtc ggtgtcggag      1380
     gtgtcgttgc cggagttgtt ggcggcggcg gtggcggtgg atccggatgc ggtggcggtg      1440
     gtgtgtgagg gtcgggggtt gtcgtatcgg gagttggatg aggcgtcgaa tcggttggcg      1500
     cgggtgttgc tcgggtcggg ggtgggttgt gagtcggtgg tggctgtggc ggtggggcgg      1560
     tcggtggagt cggtattgtc ggtgtgggcg gtggcgaaga cgggggcggc gttcgtgccg      1620
     gtggatccgg ggtatccggt gggtcggatc gagcacatgg tggctgattc gggtgtggtt      1680
     gtgggggtga cgttgtcggg ttcggtggcg gtgttgccgg gtggggtgcg gtgggtggtg      1740
     ctcgatgatg tcgagactgt ggagtggttg tcgtcggtgt cggcggggcc ggtgacggat      1800
     ggggatcggg gtgcgccggt gcgggtgggt caggcggcgt atgtgattta tacgtcgggg      1860
     tcgacgggtc tgccgaaggg ggtggtggtg tctcatcggg ggttggcgaa tgtggtggcg      1920
     tcgcagcgtg cggggttcgg gggtggtgtg ggtgcgcggg tgttgcagtg tgcgtcgccg      1980
     agtttcgatg cgtcggtgtt cgagttggtg tgggcggtgg ggttgggtgg ccggttggtg      2040
     gtggttccgc cgacggtgta tggcggggag gagttggcgc ggatcctggt ttctgagggt      2100
     gtgactcatg cggtgttgac gccgacggcg ttgtcgtcgt tggatccgtc ggggttggag      2160
     gcgttggggg ccttggttgt tgcgggtgag gtgtgtccgc cggagttggt tgcgcggtgg      2220
     gcgccgggtc ggagcatgtt caatgcgtat gggccgacgg agtcgacgat catgtcgaat      2280
     gccagtgatg ggttggtggt gggggagtcg gtgacgattg gtggtccggt tcgcgggttc      2340
     ggcgagttgg tgttggatgc gcggttgcgg ccggtgccgg tgggggcggt gggggagttg      2400
     tatttgtcgg gtccggggtt ggcgcggggg tatcggaatc gggtcgggtt gacgtcggcg      2460
     cggtttgttg cggatccgtt cggtgtgccg gggcagcgga tgtatcggac gggggatgtg      2520
     gtgcggtggc gggagggtgc gggtggtggg ttggtgctcg agtatgtggg gcgtgcggat      2580
     tttcaggtca agatccgtgg tttccgcgtc gaactcggcg aaatcgaatc agccctcctc      2640
     ggataccccg gcatcgacca cgcagtcgtc cacaccagcg gcgaccggtt ggccggatac      2700
     gtcgttcccg tcgcgggctc ggacctcgac acgtccgcgg ttctggcaca cgcccgcacg      2760
     cgcctcgccc cgcacatggt gcccgcgacc gtgacggtgc tcgacgccgt gccggtgact      2820
     gcgaacggga aactcgaccg cgcggccctg ccggaaccgg acttcaccgc ggggcgcgcg      2880
     gagtaccggg cgccgcgcaa cgcgaccgag gagatggtgg ccgccgcgtt cgccggaggg      2940
     ctcggactgg atcgggtcgg actcgacgac aactacttcg ccctcggtgg cacgtcactc      3000
     accgcgacga gcgtgatcgc ccgtatcgcc gaggacgccg cgcgggccgt gccggtgcag      3060
     tggatcttca cccatccgac accggaagcc ctggcacaca tgatcgcgac ggcgccagaa      3120
     gatgccaggg cgggggacac cgcggaccgg tcactggacg tgctgctgcc gctgcgcacc      3180
     accggaacgg gcagcccggt gttctgcatc catcccgcga tcgggttggc ctggtgcttc      3240
     accggactgg tgcagtatct cggcgaccgt ccggtctacg ggctgcagtc cccggcgctg      3300
     accgacccgg acctgcggat cgactccctg caggaactcg cgggccggta tgtcgaccgg      3360
     atccgttcgg tgcagcccca cggcccgtac cacctggtgg gctattcggt cggcggtcag      3420
     atcgcccatg agatggcggt gcagctcacg ggcgccggcg acgaggtggc caccctcacg      3480
     atgctcgaca cccatctggc gggaggtctc gatcgcacag ccgagaagcc caccatggca      3540
     gcacttctcg cggagttcgg cgcggtcgtc ccgcgtgacg gcgacgatgc gacgaccacc      3600
     gagcgtgccg tggaggtgct gcgccgcacc ggcgggccgt tcgcggccgt gaccgcggac      3660
     gacctcgacg ctgtgcaccg ggtgttcacg cagacggtcg acctcgcgct cgcacaccga      3720
     ccgtcgacac cgagcggcgt cgatctgctg tacttcggag cggcagattc cgtcgacgct      3780
     cccaccggtg tctccgcgtg gcggcagcac atcaccggcg agatcctcgt gcaccacgtt      3840
     cccgctgcac accagcagat gacgagtccg gaagcccttg ccggcatcgg ccccgtcctc      3900
     gcacaccacg tcctgctcgc cgacaagccg atgcgcgtcg tgtcgtcgta g               3951
//

If you have problems or comments...

PBIL Back to PBIL home page