(data stored in ACNUC7421 zone)

EMBL: AP011115.PE470

AP011115.PE470       Location/Qualifiers
FT   CDS_pept        480170..480505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48717"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP0"
FT                   /protein_id="BAH48717.1"
FT                   /translation="MRSVTFAPAAARHVGRRMPVSGQAMGSGTENRMRRREIPVPRADS
FT                   MTESGTERRPTIALPMARAVPKQQDSSHADRIFASSRFEFFSGVSRSAVLRDDPRPKGV
FT                   VERCRHR"
     gtgaggtcgg tgacgttcgc gcccgccgcg gccaggcacg tcgggcgccg tatgccggtg        60
     agcggccagg ccatgggcag cggcaccgag aacagaatgc gtcgacggga gatcccggtc       120
     ccgcgtgcgg attcgatgac cgaatcgggg accgagcgca ggccgacgat tgcgttgccg       180
     atggcacggg cagtcccgaa acaacaggat tcgagtcacg ccgatcggat cttcgcatct       240
     tcgcgattcg aattcttctc cggcgtcagc cgatcggctg tactacgaga cgatccgaga       300
     ccgaaggggg tagtcgaacg atgtcgacac cggtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page