(data stored in ACNUC7421 zone)

EMBL: AP011115.PE471

AP011115.PE471       Location/Qualifiers
FT   CDS_pept        480511..480765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04710"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48718"
FT                   /db_xref="GOA:C1ARP1"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP1"
FT                   /protein_id="BAH48718.1"
FT                   /translation="MQRHDTELWQWRLSARCHEEDVEIFFPADAERRNARFEREDLAKE
FT                   FCRGCAVVEECLAYALDTGQQHGVWGATTPGERLARLDR"
     ttgcagcgtc acgacacaga gctgtggcag tggcgattgt ctgcgcggtg ccatgaagaa        60
     gacgtggaga tcttcttccc ggccgacgcc gaacgcagga acgcgcgctt cgagcgggaa       120
     gatctcgcca aggagttctg ccgcggctgc gcggtggtgg aggaatgcct cgcgtatgcc       180
     ctcgacaccg gccaacagca cggagtctgg ggagcaacga cgccgggtga acgactggca       240
     cgtctggacc gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page