(data stored in ACNUC7421 zone)

EMBL: AP011115.PE474

AP011115.PE474       Location/Qualifiers
FT   CDS_pept        complement(481836..481997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP4"
FT                   /protein_id="BAH48721.1"
FT                   /translation="MVNNRHPAKNRTGTWNAVVVPPGSGGRFAVAVADEQSGIAMAATD
FT                   AAAQATIE"
     gtggtcaaca acaggcatcc tgcgaagaac cggaccggga cctggaacgc tgtggtcgtc        60
     cctcccgggt cgggcggcag gttcgctgtc gcggtggcgg acgagcagag cgggatcgcg       120
     atggccgcca cggatgccgc cgcccaggcc acgatcgaat ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page