(data stored in ACNUC7421 zone)

EMBL: AP011115.PE475

AP011115.PE475       Location/Qualifiers
FT   CDS_pept        482495..482872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48722"
FT                   /db_xref="GOA:C1ARP5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP5"
FT                   /protein_id="BAH48722.1"
FT                   /translation="MLNSEISNPVRSTRSFLDRRRGPSDRELVTTAKAVLITRRGYSDA
FT                   QAFDELLDVARRHHLSVQGAARCLIDLTSNTGHLTSRRPVTFPEWEGLRGQPSGHHRRP
FT                   SQRMDSLQGRHHPHLATQIRP"
     atgttgaatt cagagatctc gaaccccgtg cggtccaccc ggagcttcct cgaccggcga        60
     cgagggccgt cggaccgtga actcgtgacc accgcgaagg cggtcctgat caccagacgc       120
     gggtacagcg atgcccaggc cttcgacgaa ctactcgacg tggcgcgccg acaccacctc       180
     tccgtacagg gcgctgcccg atgcctgatc gatctcacca gcaacaccgg tcacctcacg       240
     agtcgcaggc cggtcacgtt tcccgagtgg gaaggactcc gggggcagcc ttccgggcac       300
     caccgtcgtc cgtcgcagcg aatggacagt ttgcagggac gccaccaccc tcacctcgcg       360
     acacagattc gaccgtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page