(data stored in ACNUC7421 zone)

EMBL: AP011115.PE477

AP011115.PE477       Location/Qualifiers
FT   CDS_pept        complement(484082..484750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48724"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP7"
FT                   /protein_id="BAH48724.1"
FT                   /translation="MAVGATRRRPRRRMPIVYARSSTFDAHPSFIDEGIKHVRDTVMPA
FT                   LADIAGSAGMSLLVDRGSGRCIATSSWTDDEALRASEAPVRQLRDRMAEVFHATATVAR
FT                   WDIAALHRDHRSHHGAWVRVAWLDVEPGHLDRVIDVYKMSSLPAMHELAGFCSASLLVD
FT                   PAAGRVVSSMTFDSAPAEAGARDAVESIGTSEIRESGARLLEVGEFELAIAHLHVPEMA
FT                   "
     ttggccgtcg gcgccacgcg gcgccgcccg aggagaagga tgcccatcgt gtatgcacgc        60
     tcttccacct ttgatgcgca cccgtcgttc atcgacgagg ggatcaagca tgtccgcgac       120
     accgtgatgc ccgcgctcgc cgacatagca ggatccgccg gtatgtccct gctggtcgat       180
     cgcggctccg gccggtgcat cgccaccagc tcctggacgg acgacgaggc gctccgcgcg       240
     agcgaagcac cggttcggca gctgcgtgac cgcatggccg aggtcttcca cgccaccgcc       300
     accgtcgcac ggtgggacat cgcggctctg caccgtgacc accggtcaca tcacggtgcc       360
     tgggtgcggg tcgcgtggct cgatgtcgag ccgggtcacc tggaccgtgt gatcgacgtg       420
     tacaagatgt cctcgctgcc cgccatgcac gagctcgcag gattctgcag cgcgagtctg       480
     ctcgtcgacc cggccgccgg tcgtgtggtg tcgtcgatga ccttcgacag cgccccggcg       540
     gaggccggtg cccgtgacgc ggtcgagagc atcggcacgt cggaaatccg tgagtccggc       600
     gcccggctcc tcgaggtcgg ggagttcgaa ttggcgatcg cacatctgca cgtacccgag       660
     atggcgtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page