(data stored in ACNUC7421 zone)

EMBL: AP011115.PE479

AP011115.PE479       Location/Qualifiers
FT   CDS_pept        complement(485032..485361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48726"
FT                   /db_xref="GOA:C1ARP9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP9"
FT                   /protein_id="BAH48726.1"
FT                   /translation="MIEDSTEPSLTPVPSPTRLIPRRRPDGRELLGTAKGILIAGRGCT
FT                   DAQAFDELLDVARRHHLTVLGAARSLVELAAGPSPRPRRADTARFDEWEQLVAQLPPRR
FT                   HAQAS"
     atgatcgagg acagcaccga accatccctc actccagtac ccagcccgac gcgcctgatc        60
     ccgaggaggc gccccgatgg ccgagaactg ctcggcacgg ccaagggcat tctgattgca       120
     ggccgcggct gcaccgacgc ccaggcattc gacgaacttc tcgacgtcgc gcgccgccat       180
     cacctgaccg tcctcggcgc tgcccggagc ctggtcgagc tggcggccgg tccctcaccc       240
     cggccgcgtc gggccgacac cgcccgattc gacgagtggg agcagttggt cgcccaactc       300
     cctccccgcc ggcacgctca ggcaagttga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page