(data stored in ACNUC7421 zone)

EMBL: AP011115.PE480

AP011115.PE480       Location/Qualifiers
FT   CDS_pept        complement(485723..488263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04800"
FT                   /product="UvrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48727"
FT                   /db_xref="GOA:C1ARQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ0"
FT                   /protein_id="BAH48727.1"
FT                   /translation="MPTPDPGPPAEPSPAREFAGIEVFDASEHNLAHVDVFIPRDCIVA
FT                   FTGVSGSGKSSLAFGTIYAEAQRRFLESVTPYARRLMDQVGAPRVGDITGLPPAVALQQ
FT                   ARGHTSARSSVGTLTHISNVLRMLFSRAGTYPPDAAELDSNAFSPNTPEGGCPTCHGLG
FT                   RTHDVDVDALVPDPSRSIRDGAVAAWPGAWLGKNYRDILDTLGIDVDRPWSELPAHQRE
FT                   WILTTDEQPTVTVSPIRDPGKMVRDYQGTFSSARTYVLHTFATTKSATQRAKVSRYLLS
FT                   RPCSACDGKRLRPEALAVRFAGLDIADATALPMSELATALDAAVGSRDAAADDATDRAS
FT                   EALVDNLLGRLRGLSELGLGYLSLGRSTTTLSPGELQRLRLATQLQSGLFGVLYVLDEP
FT                   SAGLHPADTEALVAAVRRLRAAGNSVFVIEHNLDIVRAADWIVDVGPDAGEHGGRVLYS
FT                   GTVDGLAETPESVTRRYLFEPREHRPEPAQPSRWIELSGITMHNLRDLTVRIPLGVLTA
FT                   VTGVSGSGKSTLVSRVLTDVVAQHLGVDDEPGPDTVGDDADSTAVLADGRDTTASTVVS
FT                   SHGLGHIDRLVRVDQTPIGRTPRSNLATYTGLFDVIRKLFAAHPTARERGYSPGRFSFN
FT                   VTGGRCDECEGAGAITIGMLFLPEASAPCPVCAGARYNTETLEILVDGRSIADVLAMTA
FT                   DEAGDFLNHVPAAKKSLDMLVEVGLGYLRLGQSATTLSGGEAQRVKLASELQRIRSGHT
FT                   LYVLDEPTTGLHPADVDRLMVVLRRLVAAKNTVVLVEHDMSVIAAADWMIDLGPGGGDN
FT                   GGRVIASGQPVTVAATADSATAAHLGRHLAPANG"
     gtgcccaccc ccgatcccgg accgccggcc gaaccatcac ccgcccggga attcgcgggc        60
     atcgaagtgt tcgatgccag cgagcacaac ctcgcccatg tcgacgtgtt cattccccgg       120
     gactgcatcg tcgccttcac cggtgtgtcg ggatcgggca agtcgtcgtt ggccttcggc       180
     accatctacg ccgaagcgca acgacgcttc ctcgagtccg tcaccccgta cgcacggcgc       240
     ctgatggatc aggtcggagc gccccgggtg ggggacatca ccggacttcc accggcggtc       300
     gcgttgcagc aggcccgcgg ccacacctcc gccagatcgt cggtcggcac actgacccac       360
     atctccaacg tgctgcgaat gctgttctcc cgggccggca cctacccgcc ggacgccgcc       420
     gaactcgact cgaacgcctt ctctcccaac acaccggaag gaggatgccc gacctgccac       480
     ggcctcggcc gcacccacga cgtcgacgtc gacgccctgg tcccggaccc gagccgcagt       540
     atccgcgacg gtgccgtcgc cgcgtggccc ggtgcctggc tgggaaagaa ctaccgcgac       600
     atcctcgaca ccctcgggat cgatgtggac cgcccctggt cggaactccc tgcacaccaa       660
     cgtgagtgga tcctcaccac cgacgagcag cccacggtca cggtgtcacc gatccgcgac       720
     ccgggcaaga tggtgcgcga ctaccaggga acgttctcga gcgcccgcac ctacgtcctg       780
     cacaccttcg cgacgacgaa gagcgcaacc cagagggcga aggtctcgag gtatctgctc       840
     tcccgcccct gcagcgcctg cgacggcaag cggctgcgac cggaggcgct ggccgtgcgg       900
     ttcgccggcc tcgacatcgc cgacgcgacc gcactgccga tgtccgagct ggccacggcc       960
     ctcgacgccg ccgtcggatc ccgtgacgcc gccgcagacg acgccaccga tcgagcatcg      1020
     gaggcgttgg tggacaacct actcggacga ctccgggggt tgtccgagct cgggctggga      1080
     tacctgagcc tcggccgatc gaccaccacc ctgtccccgg gagagctcca gcgcctgcgc      1140
     ttggccaccc agctgcagtc gggcctgttc ggcgtgctgt acgtcctcga cgaaccgtcc      1200
     gcgggcctgc accccgccga caccgaggcg ctggtcgccg ctgtgcggcg gcttcgcgcg      1260
     gcaggcaact ccgtcttcgt catcgaacac aacctcgaca tcgtccgggc ggcggactgg      1320
     atcgtcgacg tcggtcccga tgcgggggag cacggtggga gggtgctcta cagcggcacg      1380
     gtggacggtc tcgcggagac tcccgaatcc gtcacccgcc gatacctttt cgaaccacgg      1440
     gagcatcgcc cggagcctgc acagccgagc aggtggatcg aactctccgg catcacgatg      1500
     cacaatctgc gggatctgac cgtgcggatc ccgctcggtg tgctcaccgc ggtcaccggg      1560
     gtgtccggat cgggcaaatc cacgctcgtc agccgtgtgc tcaccgatgt cgtcgcccag      1620
     cacctcggcg tcgacgacga gcccggcccc gacacagtgg gagacgacgc cgactccacg      1680
     gccgtcctcg ccgacggccg cgacaccacc gcgtcgacgg tggtgtcgtc gcacgggctc      1740
     ggtcacatcg accggctggt gcgggtggac cagactccga tcgggcggac tccacgctcg      1800
     aatcttgcaa cctacaccgg actcttcgac gtgatccgga aactcttcgc tgcccacccg      1860
     accgcccgcg aacgcgggta cagccccggc cgattctcgt tcaacgtcac cggtggccga      1920
     tgcgacgagt gcgagggcgc cggtgcgatc accatcggca tgctgtttct ccccgaggcc      1980
     tccgcaccgt gcccggtctg cgccggcgca cgctacaaca ccgagactct cgagatcctc      2040
     gtcgacggcc ggtcgatcgc cgacgttctc gcgatgaccg ccgacgaggc cggggacttc      2100
     ctgaaccacg tcccggccgc gaagaagagc ctcgacatgc tggtagaggt aggtctcgga      2160
     tatctgcggc tcggccaatc cgccaccacg ctgtcgggtg gggaagcgca acgcgtcaag      2220
     ctggccagcg aattgcagcg catccgatcc gggcacacgc tctacgtgct cgacgaaccc      2280
     accaccggat tacaccccgc cgacgtggac cgactcatgg tggtgctgcg ccgtctcgtc      2340
     gcggcgaaga ataccgtcgt cctggtcgaa cacgacatgt cggtgatcgc cgcggcggac      2400
     tggatgatcg atctcgggcc cggcggcgga gacaacggcg gccgcgtcat cgcctcgggt      2460
     cagccggtga ccgtcgccgc gacggccgat tccgccaccg ccgcacacct cggccggcat      2520
     ctcgccccgg ccaacgggta g                                                2541
//

If you have problems or comments...

PBIL Back to PBIL home page