(data stored in ACNUC7421 zone)

EMBL: AP011115.PE488

AP011115.PE488       Location/Qualifiers
FT   CDS_pept        complement(498816..499004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48735"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ8"
FT                   /protein_id="BAH48735.1"
FT                   /translation="MNRTDLPQTLRRSSKEVQAAFATAHETAVRRYGEGEEAQRAAYGE
FT                   LKQSYELVTDHWVPKQD"
     gtgaaccgga ccgacctccc acagacactg cggagatcat cgaaggaggt gcaggccgct        60
     ttcgccacgg cacacgagac agccgttcgg cggtacggcg agggcgagga agctcaacga       120
     gcggcatacg gggagctcaa acaatcgtac gaactcgtca cggaccactg ggtgcccaag       180
     caggactga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page