(data stored in ACNUC7421 zone)

EMBL: AP011115.PE489

AP011115.PE489       Location/Qualifiers
FT   CDS_pept        499221..499475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48736"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ9"
FT                   /protein_id="BAH48736.1"
FT                   /translation="MPVSPHTLLQHVQDRTTDLRRWLDTGENTATLTAYLRDEPVDHRW
FT                   LSTYRRLTHDLLRAVDHACPPREPHDAPTPSVGRQSDLQ"
     atgcccgttt cgccacacac tttgttgcag cacgtccagg atcgcaccac cgacctacgc        60
     cggtggttgg ataccggcga gaacaccgcc accctgactg catatctgcg cgacgaaccc       120
     gtcgaccacc gatggctctc cacctaccga cgactcaccc acgacctgct gcgggcggtc       180
     gaccacgcct gcccgcccag ggaaccgcac gacgcaccga cgccgagcgt cggccgccaa       240
     tcggacctgc aatga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page