(data stored in ACNUC7421 zone)

EMBL: AP011115.PE49

AP011115.PE49        Location/Qualifiers
FT   CDS_pept        complement(41126..41503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS47"
FT                   /protein_id="BAH48296.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGEEVGWAA
FT                   SPLSDDEVYDASNYLFKEGYVTGMPVKDVGIPRPMLTLVGRRVAKTGNPLRSKANARDA
FT                   KPRRRPGTFAEASVTTAGTAK"
     gtgagtgcag ctaccgatcg tcagtgggcg gttcgtgacg ctgtcctgcg ttggcttctt        60
     gccaagacaa cggagggtta tcgcagcccg atcctggacg cggatgccat cggggaagaa       120
     gtcggatggg cagcgtcgcc gctcagcgac gacgaggtgt acgacgcctc gaactatctc       180
     ttcaaggaag gctatgtgac aggcatgccg gtgaaggatg tcggaattcc tcgaccgatg       240
     ctgactcttg tcggacgtcg tgtggccaag acaggcaacc ccctgcggtc caaggctaac       300
     gctcgcgacg ctaagccgcg ccggcgcccg gggactttcg cagaggcatc cgtgacgaca       360
     gcgggcacag cgaagtag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page