(data stored in ACNUC7421 zone)

EMBL: AP011115.PE495

AP011115.PE495       Location/Qualifiers
FT   CDS_pept        504522..505031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48742"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR5"
FT                   /protein_id="BAH48742.1"
FT                   /translation="MLIYSMSVEEDGFIADREGGFGWTVPTRSTRQRPSQCPARRGAAN
FT                   DPSMTSRFSSNLVRGIIVATSVLTAACSSGGAERSAPLVGVETSTAPATPDTPGTLPTA
FT                   NELTALYNTALDYDVPLSDRVNLIQGVDEADPRLAQKFVQEEMTVAFHAVLDRGDGSLL
FT                   AFGNPS"
     atgctgatct attcgatgag cgttgaggag gacggcttca tcgccgaccg cgagggcggc        60
     ttcgggtgga cggtgcccac gagaagcact cgacagcgtc caagccaatg cccggctcgc       120
     cgaggagccg cgaacgatcc gtcgatgacg tctcggttca gctccaacct ggtcagaggc       180
     atcatcgtcg caacgtcagt gctgacggct gcgtgcagtt cgggcggcgc tgagcgatca       240
     gctcccttgg tgggagtgga aacgtcaacc gcgccagcca cacccgacac accgggaacg       300
     ctcccgacgg cgaacgagct gactgctctg tataacactg ccctcgacta cgacgtcccc       360
     ttgtccgacc gagtgaacct gattcagggc gtcgatgagg ccgatcctcg actcgcccag       420
     aagttcgttc aagaggaaat gaccgtcgca ttccacgcag tgctggaccg tggcgatggg       480
     tccttacttg ccttcggcaa cccatcgtaa                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page