(data stored in ACNUC7421 zone)

EMBL: AP011115.PE5

AP011115.PE5         Location/Qualifiers
FT   CDS_pept        3160..3567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48252"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS03"
FT                   /protein_id="BAH48252.1"
FT                   /translation="MGRTRPCDQAVRRGRLKKAEQFFHLAEIGRDFADEPDGVDDAVVT
FT                   LWVHAGIAASDVICCARLGKHAQGEDHKDAVTVLGSVDPTTAKHLSVLLGLKTRSGYTD
FT                   MPTSRTESKRAERAAEALIEAARRAHAQAGT"
     atggggcgga cgcggccgtg tgaccaggcg gtccgccgag gccggctgaa aaaagccgaa        60
     cagttctttc acctggccga gatcggtcgc gacttcgccg acgagccgga cggtgtcgac       120
     gatgcggtcg tgaccttgtg ggtgcacgcg ggcatcgcag cctcggatgt catctgttgc       180
     gcgcgactgg gtaagcatgc gcagggcgag gaccacaagg atgccgtcac ggtgctcggg       240
     tccgtcgacc cgaccacggc gaaacacctc agcgtgctgc tcggcctcaa gacgcggtcc       300
     ggttacaccg atatgccgac gagccgcacc gaatcgaagc gcgccgaacg tgccgccgaa       360
     gctctgatag aggctgcccg tcgcgcgcac gctcaggccg gaacgtaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page