(data stored in ACNUC7421 zone)

EMBL: AP011115.PE50

AP011115.PE50        Location/Qualifiers
FT   CDS_pept        42310..42867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48297"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS48"
FT                   /protein_id="BAH48297.1"
FT                   /translation="MRVLNVMQRPVRVVRQSDSMRTAAVLLAEYGFAAVPVVDDHDRLV
FT                   GMLNSGDVLRAGTASSETVGEVMTAPAVAAPMYQYVADVSKMLLHQGLRSLPVVDIDGR
FT                   VVGILSRSDVVRLMLKPDETIAVGAQRRLDDYTGDGRWHVTVEEGCVTLAGPFADESER
FT                   RIAIALSKTVPGTRMVSIAAGE"
     atgcgagtgt tgaacgtgat gcagcgaccg gttcgagtgg tgcgccaatc cgacagtatg        60
     cgcacggccg cagtgctact ggccgagtac gggttcgcgg cggtgccggt ggtcgacgac       120
     cacgaccggc tggttgggat gttgaacagc ggagacgtgt tgcgggccgg taccgcgtcc       180
     tcggagacgg tgggcgaggt gatgactgca cccgccgttg ctgcgccgat gtatcaatat       240
     gtggccgatg tgagcaagat gctacttcac cagggactac gcagtctgcc ggtcgtggat       300
     atcgacggtc gggtagtggg catcctcagc cgcagtgacg tggtgcggct gatgctcaaa       360
     ccggacgaga cgatcgccgt gggcgcgcaa cgccgcctcg acgactacac cggggacgga       420
     cgctggcacg tgacggtcga ggagggctgc gtcaccctcg caggcccgtt cgcagacgaa       480
     tccgaacgcc gcatcgcgat cgcgttgagc aagaccgtac cgggcacccg catggtgtcc       540
     attgccgctg gagaatag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page