(data stored in ACNUC7421 zone)

EMBL: AP011115.PE502

AP011115.PE502       Location/Qualifiers
FT   CDS_pept        complement(512316..513503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48749"
FT                   /db_xref="GOA:C1ARS2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS2"
FT                   /protein_id="BAH48749.1"
FT                   /translation="MNLIDQHAAVLPTDAANATLVGRVHDDAIGGPCIVTLRSGAVVDI
FT                   TDAFPTMTDLLESPDPVKAVRSAVGTRSWPIADVLASSLTARTTAPYLLAPVDLSVLKA
FT                   AGVTFATSLLERLIEERAGGDPEQADAIRGDFERLIGSTLSSIEPGSEDAARLKEDLKS
FT                   RGQWSQYLEVGLGPDPEVFTKAPVLSAVGCGSEIGVAQVSSWNNPEPEVALAVTSTGRI
FT                   VGAMLGNDVNLRDVEGRSALLLPKAKDNNASASLGPFIRLLDESFTLDDVRAAEVRLQV
FT                   LGEDDGFVLDDVSYMREISRDISTLAEYTVGDAHQYPDGIVLYTGTLFSPTHDRGGEGM
FT                   GFTHHIGDVVRISSPKLGTLVNRVNHSEKAQRWEFGLRSFIANLHGRGLVGKVGA"
     atgaacctca tcgatcagca cgcagcggtc ctgcccaccg acgcggccaa cgccacgctc        60
     gtcggccgcg tccacgacga cgccatcggc ggcccgtgca tcgtcaccct gcgctcgggt       120
     gcggtggtcg acatcaccga cgccttcccg accatgaccg atctcctcga atcaccggac       180
     ccggtcaagg ccgtccgcag cgcggtcggc acccggtcct ggcccatcgc cgacgtcctc       240
     gccagctccc tcaccgcccg caccaccgcc ccgtacctgc tcgcaccggt cgacctgtcg       300
     gtgctcaagg ccgccggggt gacgttcgcg acgtcgctgc tcgaacggct catcgaggag       360
     cgcgccggcg gcgaccccga acaggccgac gccatccgcg gcgacttcga gcgcctcatc       420
     ggatcgaccc tgtcctccat cgaacccggc agcgaggacg cggcgcggct caaggaagac       480
     ctcaaatctc ggggccagtg gtcccagtac ctcgaggtgg gattgggccc ggatccggag       540
     gtcttcacca aggctccggt cctctcggcg gtcgggtgcg gctccgagat cggtgtcgcc       600
     caagtctcgt cgtggaacaa cccggaacca gaggtcgccc tcgcggtcac ctccaccggc       660
     cgcatcgtgg gtgcgatgct gggcaacgac gtcaacctcc gcgatgtcga gggccgctcg       720
     gcgctgctgc tgccgaaagc gaaggacaac aacgcctccg cctcgctcgg accgttcatc       780
     cggttgctcg acgaatcgtt caccctcgac gacgtccgcg ccgccgaggt acgtctgcag       840
     gtgctggggg aggacgacgg cttcgttctc gacgacgtga gttacatgcg cgagatctcc       900
     cgcgacatca gcacccttgc cgagtacacc gtgggcgacg cccatcagta cccggacggg       960
     atcgttctct acaccggcac cctgttctcg ccgacgcacg accgcggcgg cgagggcatg      1020
     ggattcaccc accacatcgg tgacgtagtg cgaatctcga gcccgaaact cggcaccctc      1080
     gtcaaccgcg tcaaccactc cgagaaggcg cagcgctggg agttcgggct gcggtcgttc      1140
     atcgccaacc tgcacgggcg cggactggtc gggaaggtcg gtgcctga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page