(data stored in ACNUC7421 zone)

EMBL: AP011115.PE505

AP011115.PE505       Location/Qualifiers
FT   CDS_pept        complement(515372..516958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05050"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48752"
FT                   /db_xref="GOA:C1ARS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS5"
FT                   /protein_id="BAH48752.1"
FT                   /translation="MVPDQETRTAMTSNDSSPTPSIEIIALSKEFGVNRVLDNVNLEFR
FT                   PGSINALLGANGSGKSTLIKLLAGYHTPTSGTIRVHGDELALPADPTVLHDAGVRFVHQ
FT                   DLGLIESMSIADNLALALGYEKRAATINWRRQRATAVADLAAVGLDDLDPRALVGALGP
FT                   VQQTLVAMARALRGLQPGRGVLVLDEPTARLPNAQVDELLTRCRLLRDQGIALIYVSHR
FT                   LDEVFAMADRVSVLRDGRLVFDDVIAATDDQHLTQIITGGATTDETADHPAPARRVVDP
FT                   GTPPKLALRGVCGTFVQDVDLDLRPGEVLAVTGLVGSGRSELGRLIFGSQAITAGEVRL
FT                   RGQQLRRISPKLSIERGIGYVPQDRKQSAIPSFTLADNLCLASLDKHMSAGLLSAESER
FT                   TVTASAIERLDVRPADPERLLGELSGGNQQKIVLGKWLELDLDVLILDEPTYGVDVGAR
FT                   KTILEAVLEQVGRRQLSVLLLDSDIDLVARYADRVLVMRRGRIATELVGAEITTERIAA
FT                   ASYAVQDLSTA"
     atggtccccg accaggaaac gagaaccgca atgacatcga atgactcgtc accgacgccg        60
     agcatcgaaa taatcgcact gtcaaaggaa ttcggagtca accgggttct ggacaatgtt       120
     aatctggagt tccggccggg ttcgattaat gccctgctcg gcgcgaacgg atccggaaag       180
     tcgaccctga tcaagctgct cgccggctac cacaccccca ccagcggaac catccgcgtg       240
     cacggtgacg aactggcctt gcccgccgac cccacggtgc tgcacgacgc cggggtgcgg       300
     ttcgtccatc aggacctcgg actcatcgag tcgatgtcga tcgccgacaa cctggcgttg       360
     gccctcggct atgagaagcg cgccgccacg atcaactggc gccgtcagcg ggcaaccgcg       420
     gtcgcggacc tcgccgcagt cgggctcgac gatctcgacc cccgcgccct ggtcggtgcg       480
     ctcgggccgg tacagcaaac cctcgtcgcg atggcccgag cgctgcgcgg attgcagccg       540
     ggccggggtg tgctggtgct cgacgagccc accgcgcggc tgcccaacgc tcaggtcgac       600
     gaactgctga cccggtgccg gttgctccgc gatcagggaa ttgccctgat ctacgtctcg       660
     caccgcctcg acgaggtgtt cgcgatggcg gaccgggtgt cggtgctgcg cgacggccga       720
     ctggtcttcg atgacgtcat cgccgccacg gacgatcagc acctgacgca gatcatcacc       780
     ggcggggcca ccacggacga aaccgccgac cacccggcgc cggcccgacg agtcgtcgat       840
     ccgggaacac cgccgaagct ggcgttgcgt ggagtgtgcg gaacgttcgt gcaggatgtc       900
     gatctcgacc tgagaccagg ggaggtgctg gcggtcacgg gcctggtcgg gtccggtcgc       960
     agcgagctcg gccgactgat cttcggttcg caggccatca ccgccggcga agtccggctc      1020
     cgcggtcagc agctccgccg gatttcgccg aagctcagca tcgaacgcgg catcggatac      1080
     gtcccccagg accgcaagca gagcgcgatc ccgtccttca cgctggcaga caacctctgt      1140
     ctggcgagcc tcgacaagca tatgagcgcc ggcctgctat cggccgaaag cgagcggacg      1200
     gtgaccgcga gtgcgatcga gcgcctggac gtgcgcccgg ccgatcccga acgcctcctc      1260
     ggtgagctgt ccggcggaaa ccagcagaag atcgtcctcg gtaagtggct cgaactcgac      1320
     ctcgacgtcc tcatcttgga cgaaccgacc tacggcgtcg atgtcggcgc ccgcaagacg      1380
     atcctcgagg ccgtcctcga acaagtcggc cggcgtcaat tgtctgtgct gctactggac      1440
     tcggacatcg acctggtcgc ccgctacgcc gaccgagtgc tcgtgatgcg tcgtgggcgt      1500
     atcgcgaccg aactcgtcgg cgcagagatc accaccgaac gaatcgcggc ggcgagctac      1560
     gccgttcagg acctttccac ggcctaa                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page