(data stored in ACNUC7421 zone)

EMBL: AP011115.PE515

AP011115.PE515       Location/Qualifiers
FT   CDS_pept        531041..531937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48762"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART5"
FT                   /protein_id="BAH48762.1"
FT                   /translation="MTTTQTPALLAACWTSAGDVMPARGSDLSPVPIRERIEAVARTGY
FT                   TGFGLTRPDLVAARETVGLGEVAKMLADNGITQVQLEWITNWWTTGDARAASDEVRRDL
FT                   FEAAPVLGVDNIKVGADDDGVPVSRDLLVEQFDALASDGAGVGVKIAFENTPFSHHIKT
FT                   TEQAAQFVKDVDNPNGGLILDIWHAFRGGTDYDTLPQLVPARFVFGVELDDGWSTVRGT
FT                   DLEDTFDNRVPCGEGEFDVPKFINAVRRIGFDGPWGIEHMSEEFRQLPVADALARARTG
FT                   ALQCFARADEQAAGKRS"
     atgacaacca cccagacacc ggcactgctg gccgcatgct ggacctccgc gggcgatgtg        60
     atgccggcgc gaggctccga tctgagtccg gtcccgatcc gcgagcgcat cgaggcggtc       120
     gcacggaccg gctacaccgg cttcggcttg acccgacccg acctggtcgc cgcccgcgag       180
     acggtcgggc tcggcgaggt cgcgaagatg ctggccgaca acggcatcac ccaggtgcag       240
     ctggagtgga taaccaactg gtggaccacc ggtgacgccc gcgcggcctc cgacgaggtc       300
     cgccgggacc tgttcgaggc cgcccccgtc ctcggcgtcg acaacatcaa ggtcggtgcc       360
     gacgacgacg gagtcccggt gtcccgggac ctgctcgtcg aacaattcga cgccctggcc       420
     tccgacggtg ccggcgtggg cgtgaagatc gcgttcgaga acaccccgtt ctcgcaccac       480
     atcaagacca ccgagcaggc cgcgcagttc gtcaaggacg tcgacaaccc caacggtggg       540
     ctgattctcg acatctggca cgcgttccgc ggcggcaccg actacgacac cctgccgcag       600
     ctcgttcctg cacggttcgt gttcggtgtc gaactcgacg acggctggtc caccgtgcgg       660
     ggaaccgacc tcgaggacac cttcgacaac cgagttccct gcggggaagg cgaattcgac       720
     gttccgaagt tcatcaacgc ggtccgtcgg atcgggttcg acggaccgtg gggaatcgag       780
     cacatgtcgg aggagttccg gcaactgccc gtcgccgacg ccctcgcgcg ggcacggacc       840
     ggcgcgctgc agtgcttcgc gcgcgccgac gaacaggcgg ccggaaaacg gtcctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page