(data stored in ACNUC7421 zone)

EMBL: AP011115.PE518

AP011115.PE518       Location/Qualifiers
FT   CDS_pept        534152..535015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05180"
FT                   /product="putative inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48765"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART8"
FT                   /protein_id="BAH48765.1"
FT                   /translation="MIRIAGAPISWGVCEVPGWGHQLGSERVLTEMRDAGLEAAEIGPE
FT                   GFLPADPQELAATLASYDLEAVGGFTPVLLHDPDHDPVPDITGALAAFTAAGAEVLVLA
FT                   AITGTDGYDSRPDLDDAGWKTLLSNLDRLHDVAADQGIRAVLHPHVGTMIEKNIEVERV
FT                   LDGSSIPLCLDTGHLLIGGTDPLELARAAADRITHTHLKDVDAEFAARVQAGELTYTDA
FT                   VAQGMYTPLGTGDVDVAGVVRHLVASGFDGWFTLEQDTILTGEPEGEGPVADVKTSAAF
FT                   LRSLQL"
     atgattcgta ttgcaggagc acctatttcg tggggtgtgt gcgaggtgcc cggctggggt        60
     caccagctcg gttccgagcg tgtgctcacc gagatgcgcg acgccggcct cgaggccgcc       120
     gagatcggcc ccgagggatt cctccccgcc gacccgcagg agctggcggc caccctggcc       180
     tcctacgacc tcgaggccgt cggcggcttc accccggtac tgctgcacga ccccgaccac       240
     gacccggtcc cggacatcac cggcgccctg gccgccttca ccgccgccgg cgccgaggtg       300
     ctggtgctgg ccgcgatcac cggcaccgac ggttacgaca gccgccccga cctcgacgac       360
     gccggctgga agaccctgct gtcgaacctg gaccggctgc acgacgtcgc cgccgaccag       420
     ggcatccgcg cggtcctgca cccgcacgtg ggcaccatga tcgagaagaa catcgaggtc       480
     gaacgagtcc tcgacggatc ctccattccg ctgtgcctgg acaccgggca cttgctcatc       540
     ggcggcaccg acccgctcga gttggcccgc gccgccgccg accggatcac ccacacccac       600
     ctcaaggacg tcgacgccga gttcgccgcg cgcgtgcagg ccggcgaact gacctacacc       660
     gacgccgtcg cccagggcat gtacaccccg ctcggcaccg gtgacgtcga cgtcgccggt       720
     gtggtccggc acctggtggc gtccggcttc gacggctggt tcaccctcga gcaggacacc       780
     atcctcaccg gggaacccga gggcgagggc ccggtcgcgg acgtcaagac cagcgccgcg       840
     ttcctgcgga gcctgcagct gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page