(data stored in ACNUC7421 zone)

EMBL: AP011115.PE52

AP011115.PE52        Location/Qualifiers
FT   CDS_pept        43480..44001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00520"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48299"
FT                   /db_xref="GOA:C1AS50"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS50"
FT                   /protein_id="BAH48299.1"
FT                   /translation="MTPTPITTTLDTEQQRIAGKALQGTVVDLIDLSLIAKQAHWNVIG
FT                   PHFLAIHPALDELATVARKFTDEAAERATAIGVSPDGRAATVAADAGTTGFAEGWTSDG
FT                   EVVETIAANLAAVIARLRASIESTEKADPVTQDLLIGITARLEQLHWRWQAQSTQPSAQ
FT                   RPRLGQVLVG"
     atgaccccca cccccatcac caccaccctc gacaccgagc agcaacggat cgccggcaag        60
     gcactgcagg gcaccgtcgt cgacctgatc gacctgagcc tgatcgccaa acaggcccac       120
     tggaacgtca tcggacccca cttcctggcg atacaccccg ccctcgacga gctggccacc       180
     gtcgcacgca aattcaccga tgaggcggcc gaacgggcca ccgcaatcgg cgtcagcccc       240
     gacggccgcg cggccaccgt cgccgcggac gcgggtacca cgggattcgc cgaagggtgg       300
     acatccgacg gcgaggtggt cgagacgatc gccgcgaacc tggccgccgt catcgcacgg       360
     ttgcgggctt ccatcgagtc caccgagaag gcggacccgg tcacccagga cctgctgatc       420
     ggcatcaccg cccgactcga gcaactgcac tggaggtggc aggcccagag cacacaacca       480
     tctgcccagc gccctcggct cggacaggtg ctcgtcggat ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page