(data stored in ACNUC7421 zone)

EMBL: AP011115.PE520

AP011115.PE520       Location/Qualifiers
FT   CDS_pept        536146..537174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05200"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48767"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU0"
FT                   /protein_id="BAH48767.1"
FT                   /translation="MDTHNGPNASVPRKLPSRATALALSVAAAVLLAGCSSTGGKPEST
FT                   GGGMASGTADTPRATIAMITHEVPGDTFWDLIRKGAETAAAKDNIELRYSADPEAPNQA
FT                   NLVQSAIDSRVDGIAVTLAKPDAMAPAVRAAVDAGTPVVAFNGGMDQYKSLGVPQYFGQ
FT                   DEKLAGISAGQRLTADGAKKALCIIQEQGQVALETRCAGVIEGFKGQTEILNVNSKDMP
FT                   SVEATITAKLQQDPSIDHVVALGAPIALTAVQSKANANSSATIVTFDTNAALVDAIKAG
FT                   DVQWAIDQQPFLQGYLAVDSLWLYLNNRNTIGGGMPTLTGPAFIDQSNIDSIAEYAQAG
FT                   TR"
     atggacacac acaacggccc gaatgcctcc gtcccgcgga agctccccag ccgggcgacc        60
     gccctggcgc tgagcgtcgc cgcggccgtg ctgctcgcgg gatgttcgag caccggcggg       120
     aaaccggaat cgaccggtgg cggtatggcc tcgggcaccg cggacacacc ccgtgccacc       180
     atcgcgatga tcacccacga ggtgccgggc gacaccttct gggacctgat ccgcaagggc       240
     gccgaaaccg ccgcggccaa ggacaacatc gaacttcgct actcggcgga ccccgaggcg       300
     ccgaaccagg ccaacctcgt gcagagcgcc atcgacagcc gcgtcgacgg catcgccgtg       360
     accctcgcga agccggacgc gatggcaccg gccgtgcgcg ccgctgtcga cgccggcacc       420
     cccgtcgtcg ccttcaacgg gggcatggac caatacaagt ccctgggagt gccccagtac       480
     ttcggacagg acgagaaact cgccgggatc tcggccgggc agcgcctgac cgccgacggc       540
     gccaagaagg cgctgtgcat catccaggaa caagggcagg tcgcactcga gacccgctgc       600
     gcgggcgtga tcgagggctt caaggggcag accgagatcc tcaacgtcaa cagcaaggac       660
     atgccctccg tcgaagccac gatcaccgcg aagctgcagc aggacccctc catcgaccac       720
     gtcgtcgccc tcggcgcacc gatcgccttg accgccgtcc aatccaaggc caacgcaaac       780
     agttccgcga cgatcgtcac cttcgacacc aacgccgcgc tcgtcgacgc catcaaggcc       840
     ggggacgtgc agtgggcgat cgaccagcag cccttcctgc agggctacct cgccgtcgac       900
     tcgctgtggc tgtacctgaa caaccgcaac acaatcggcg gcggtatgcc gacgctgacc       960
     ggtcccgcct tcatcgacca atccaacatc gactcgatcg ccgagtacgc ccaggccgga      1020
     acccgctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page