(data stored in ACNUC7421 zone)

EMBL: AP011115.PE521

AP011115.PE521       Location/Qualifiers
FT   CDS_pept        537229..538287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48768"
FT                   /db_xref="GOA:C1ARU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU1"
FT                   /protein_id="BAH48768.1"
FT                   /translation="MSTQQDLDLSSHKVVHDERVKEQKRLQRLLLRPEIGSLFGAIAIF
FT                   VFFMIVAPPFRSPEALATVLYASSTIGIMACAVALLMIGGEFDLSAGVAVTTSSLAASM
FT                   IAYNLHLNLWAGAALALVVSLAVGFFNGYLVMKTKIPSFLITLSSFLMLTGINLAVTKL
FT                   ITGQVATPSVSDMQGFDSAKKVFASSFTIAGVSVRITVLWWLLFTAVATWVLFKTRIGN
FT                   WIFAVGGNQDSARAIGVPVTKVKIGLFMTVGFAAWFVGMHLLFSFNTVQSGQGIGNEFL
FT                   YIIAAVIGGCLLTGGYGTAIGAAIGAFIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVI
FT                   ANNAFRNYAAKR"
     atgtccacac aacaagatct cgacctgtcc agccacaagg tcgttcacga cgagcgggtg        60
     aaggaacaaa aacgcctgca acgtctgctg cttcgcccgg agatcgggtc cctgttcggt       120
     gcgatcgcga tcttcgtctt cttcatgatc gtcgcacccc cgttccgcag ccccgaagcc       180
     ctcgccaccg tcctctacgc cagctccacg atcgggatca tggcctgcgc ggtcgcactg       240
     ctgatgatcg gcggcgaatt cgacctctcc gccggtgtcg cggtgaccac cagctcactc       300
     gccgcgtcga tgatcgccta caacctgcac ctgaacctgt gggccggcgc cgccctcgcc       360
     ctcgtggtgt cgctggcggt cgggttcttc aacggctacc tggtgatgaa gacgaagatc       420
     cccagcttcc tgatcaccct cagctcgttc ctcatgctca ccggcatcaa cctggcggtc       480
     accaaactga tcaccggcca ggtcgccacc cccagcgtct ccgacatgca gggcttcgac       540
     tcggccaaga aggtgttcgc gtcctcgttc accatcgccg gggtgtccgt ccgcatcacc       600
     gtgctctggt ggctgctgtt caccgcggtc gccacctggg tgctgttcaa gacccggatc       660
     gggaactgga tcttcgccgt cggcggcaac caggactccg cccgcgccat cggcgtcccg       720
     gtcaccaagg tcaagatcgg cctgttcatg accgtcgggt tcgcggcctg gttcgtcggc       780
     atgcacctgc tgttctcgtt caacaccgtc cagtccgggc agggcatcgg caacgagttc       840
     ctctacatca tcgccgcggt catcggtggc tgcctgctca ccggcggcta cggtaccgcg       900
     atcggcgccg cgatcggcgc gttcatcttc ggcatgacga accagggcat cgtctacgcg       960
     ggctggaacc cggactggtt caagttcttc ctcggcgcga tgctgctgtt cgcggtcatc      1020
     gccaacaacg ccttccgcaa ctacgccgcc aagaggtga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page