(data stored in ACNUC7421 zone)

EMBL: AP011115.PE522

AP011115.PE522       Location/Qualifiers
FT   CDS_pept        538293..539108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48769"
FT                   /db_xref="GOA:C1ARU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU2"
FT                   /protein_id="BAH48769.1"
FT                   /translation="MSTIEQMPVDTEPGGGGKIPLIELKHVGKQYGNIIALEDINLRVR
FT                   AGEVTGVLGDNGAGKSTLIKIIAGLHQQSSGELLVDGEALTFDSPKEALSKGIATVYQD
FT                   LAVVSLMPVWRNFFLGQELRSGPMRSLDSNGMRATTQEELHKMGIDLPDVDAPIGSLSG
FT                   GQRQCVAIARAIFFGARVLILDEPTAALGVKQSGMVLRYISAAKEQGFGVVFITHNPHH
FT                   AYMVGDHFVLLNRGRQKLDCTYDEISLEELTQQMAGGDELEALTHELRR"
     atgagtacca tcgaacagat gcccgtcgat accgaacccg gtgggggcgg caagatcccg        60
     ctcatcgagc tcaagcacgt cggcaagcag tacggcaaca tcatcgccct cgaggacatc       120
     aacctgcggg tgcgggccgg tgaggtcacc ggtgtgctcg gcgacaacgg tgccggcaag       180
     tccaccctga tcaagatcat cgccgggctg caccagcaga gttcggggga actgctcgtc       240
     gacggcgagg cgctcacgtt cgactccccg aaggaggccc tgtccaaggg catcgccacc       300
     gtctaccagg acctcgccgt ggtgtcgctg atgccggtgt ggcggaactt cttcctcggc       360
     caggaactgc gctccggacc gatgcggtca ctggactcga acggcatgcg ggccacgacg       420
     caggaagagc tccacaaaat gggcatcgac ctgcccgatg tcgacgcccc catcgggtcg       480
     ctgtccggtg gtcagcgcca gtgtgtggcg atcgcccggg cgatcttctt cggcgcccgc       540
     gtcctgatcc tcgacgagcc caccgccgct ctgggtgtca agcagtccgg aatggtgctg       600
     cgctacatct ccgccgccaa ggaacagggg ttcggggtcg tcttcatcac ccacaacccg       660
     caccacgcgt acatggtcgg tgaccacttc gtcctcctca accgcggacg gcagaaactg       720
     gactgcacct acgacgagat cagcctcgaa gaactcaccc agcagatggc cggcggcgac       780
     gaactcgaag cactcaccca cgaattgcgc cgctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page