(data stored in ACNUC7421 zone)

EMBL: AP011115.PE525

AP011115.PE525       Location/Qualifiers
FT   CDS_pept        542120..542404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48772"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU5"
FT                   /protein_id="BAH48772.1"
FT                   /translation="MSERIGAELIDFGLRWAPFGGPCDDDLLVEFGMTSGTYYNRLARA
FT                   LRMRPAVQGGEAAHRSLLDMCYRQEPRSGGFEASTSDPPTPTTSTSPSK"
     atgtcagaga ggatcggtgc cgagctcatc gacttcggct tgcggtgggc accgttcggc        60
     ggaccctgcg acgacgacct cctcgtcgaa ttcggcatga cgtccggcac ctactacaac       120
     cggctagcgc gcgcgcttcg gatgcgacca gctgtccagg gcggtgaagc cgcgcaccgc       180
     tcattgctgg acatgtgcta ccggcaagag ccccgctcag gcgggttcga ggcgtccaca       240
     tccgaccctc ccacacccac caccagcacc tcccctagta aatag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page