(data stored in ACNUC7421 zone)

EMBL: AP011115.PE528

AP011115.PE528       Location/Qualifiers
FT   CDS_pept        545546..545902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48775"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU8"
FT                   /protein_id="BAH48775.1"
FT                   /translation="MTVLVAVTDTPEGAQALIAGKEEAERLGTTLLVLNLSLSEFPPTE
FT                   LAIADEADILDRSGRQARDPAVTVLDLIQERPDIERLVIGVKRRSRVGKALLGSISQRL
FT                   ILHSPVPVLAVKNE"
     atgacggtgc tcgtcgcggt aaccgacacc cccgagggtg cccaagccct catcgcaggc        60
     aaagaggaag ccgaacgcct cggaaccaca ctcctcgtgc tcaacctgtc cctcagcgag       120
     ttcccaccga ccgaacttgc catagctgat gaggccgaca tcctcgatcg cagcggacgt       180
     caagcccgcg atccggcagt gaccgtcctc gacctcatcc aggagcgccc cgacatcgaa       240
     cgcctggtga tcggtgtcaa acgccgaagc agggtcggca aggcccttct cggcagtatc       300
     agccagagac tgatcctgca ctcccccgta cccgtcctgg ccgtcaagaa cgaatga          357
//

If you have problems or comments...

PBIL Back to PBIL home page