(data stored in ACNUC7421 zone)

EMBL: AP011115.PE53

AP011115.PE53        Location/Qualifiers
FT   CDS_pept        44146..44832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48300"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS51"
FT                   /protein_id="BAH48300.1"
FT                   /translation="MIGCGRFQRLRQRVFENPIWHACASENRLLIGSVITRSPTQREPN
FT                   VIIVDFVVPGDMVARSTRRRSPTQSGPLDSRFLHQWLGRSREVTREVVLPLILDGIQYI
FT                   MRGGTAWWRLPVEFWSTGTVSAVFARKRPVHETRPETHRKGLRIWISTNPSALDGTPES
FT                   ARSGAACGTRSALSTVREAHAPVLLCLAEASDGANPPRSRSAWGVTGRWGDPSTPHRCT
FT                   HRHTNR"
     atgatcggat gcggacgatt ccagcggctg cgccagaggg tgtttgagaa cccgatatgg        60
     cacgcctgtg cctccgagaa tcggctcctg attgggtcgg tgatcaccag atcaccgacc       120
     caacgggagc ccaatgtcat catcgtcgat ttcgttgtgc ccggggacat ggttgcgcgg       180
     agtactcgtc gtcggtcacc gacgcagagt gggccactcg actcgcgatt cctgcaccag       240
     tggctcggca ggtcgcggga ggtgacccga gaagtagtgc tgccgttgat attggatggc       300
     atccagtaca tcatgcgcgg tggtaccgcg tggtggagac tgccggtgga gttctggtca       360
     accgggacgg tgtccgcggt cttcgctcgc aagagacctg tgcacgaaac tcgcccagaa       420
     actcatcgca agggtctccg gatctggatt tcgacgaacc cgtctgcact cgacgggaca       480
     ccggaatccg cacgatcagg tgcagcctgc ggtacccgtt cggctctgtc gacggtacgt       540
     gaagcgcatg cccccgtgct tctttgcctc gccgaagcgt ccgacggtgc gaatccgccc       600
     cggtccaggt cggcgtgggg tgtcaccggg cggtggggcg acccctcgac gccccaccgg       660
     tgtacgcacc gccatacgaa ccggtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page