(data stored in ACNUC7421 zone)

EMBL: AP011115.PE530

AP011115.PE530       Location/Qualifiers
FT   CDS_pept        546965..547594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48777"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV0"
FT                   /protein_id="BAH48777.1"
FT                   /translation="MSTSETWTADFANRAARRAAEPDPDWSRGCRRHPAVARLGCLRRC
FT                   YAPPVSRPWVGTGPTPYLCICVCREALRLELMVVTVAEVVALRYYRALADGGGDALPAE
FT                   VSNRILDDERHHVPFQSRRLSTGFAHTPAPARAAIGRIWRALAFAVAMVVAWNHGPALR
FT                   VLGVTRRTFVSDTKRLFDNAAAEAMHTQRNRPPHACQSAVLRGSGP"
     atgagcacgt cggagacctg gacggccgac ttcgcaaacc gggccgcgag gcgagcagcg        60
     gaacccgacc cggactggtc gcgcgggtgc cgtcggcatc ctgcggtggc acggctcgga       120
     tgcttgcggc gctgctacgc gccgccggtg tcccgaccgt gggtcggcac tggtccgaca       180
     ccatatttgt gcatttgcgt ctgtcgagag gctttgcggc tcgagctcat ggtcgtcacc       240
     gtcgcggaag ttgttgcgct gcgctactac cgtgcgctcg ccgacggcgg cggtgacgcg       300
     ctgccggccg aagtatccaa ccgaatcctc gacgacgagc gacaccacgt cccgttccag       360
     agccgtcgcc tgagcaccgg cttcgcccac acaccggcgc cggcgcgagc cgcgatcggg       420
     cggatttggc gcgcactggc gtttgcggtt gcaatggtcg tcgcatggaa tcacggaccg       480
     gccctgcgcg tgttgggcgt gacacggcgg accttcgtct ccgacaccaa gcggttgttc       540
     gacaacgccg ccgcagaggc catgcacaca cagagaaaca ggccgccgca cgcctgccaa       600
     tccgcggtac tccgcggatc aggaccgtga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page