(data stored in ACNUC7421 zone)

EMBL: AP011115.PE531

AP011115.PE531       Location/Qualifiers
FT   CDS_pept        548077..549159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48778"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV1"
FT                   /protein_id="BAH48778.1"
FT                   /translation="MLDDAATGRFAVVPVVARSVGAGFGVAWIEREVSVVGVRVETVGE
FT                   GEPIGLDDVDTRVRWLLDLISGAEAQMLSRLWQPATFDVLAAGVDRQGRKLATQGHVAA
FT                   ARLGWTPHYPDGVYVPSRVTRVVTAQVMASLRTLAFRDTAIASLSERFDPATGRIAPPT
FT                   AAADWMPPGFARGVRRQLIARARRDGDAVPSGRLRITDMQAPPQTSAMARLSAADRQLA
FT                   QLTVAERELVLTVKLPTTPAPTGRAQWRSVRLTAAIPAHLHGRAITDWHLPTLVLDKKG
FT                   LLLRCAATELVPSGDLGSATVAVGWIGPRPRSVPPPSPPTARRGWSRTFGVSRTTTAAS
FT                   GPNSPACRPKASCCTARPPG"
     atgctcgacg acgcagccac cggccggttc gcggtggtgc cagtggtggc gagatcggtt        60
     ggcgcgggtt tcggggtggc gtggatcgag cgtgaggtgt cggtggtcgg cgttagggtc       120
     gagaccgtcg gtgagggtga gccgatcggg ctcgacgacg tcgacacccg ggtgcggtgg       180
     ctgctcgacc tgatctcggg cgccgaagcg cagatgctgt cgcggctgtg gcaaccggcc       240
     accttcgatg tcctcgccgc cggcgtggac cgccagggcc gcaagctcgc gacgcagggc       300
     catgtcgctg ctgcgcgtct gggctggacc ccgcactacc cggacggggt gtacgtgccg       360
     tcgcgggtga cgcgggtggt gacggcgcag gtgatggcgt ccctgcggac cctggccttc       420
     cgggacaccg cgatcgcgtc gctgtctgag cggttcgacc cggccaccgg gcggatagcc       480
     ccacccaccg ctgccgcgga ctggatgccg cccggtttcg ctcggggcgt gcggcgccag       540
     ctgattgccc gcgcccgccg cgacggcgac gcggtgccgt ccggccggtt gcggatcacc       600
     gacatgcagg caccaccgca gacgagcgcg atggcccggc tctcggccgc cgatcggcag       660
     ctcgcacaac tcacagtggc agagcgtgag ttggtgttga cggtgaaact gcccaccact       720
     cccgccccga ccggacgcgc gcagtggcgc agtgttcggc tgaccgccgc catccccgcg       780
     cacctgcacg gccgggcgat caccgactgg catctgccga ccctcgtcct cgacaagaaa       840
     ggcctgttgt tgcggtgcgc ggccaccgaa ctcgtccctt ccggtgacct gggatcggcg       900
     accgtcgcgg tggggtggat tggtccccgt ccacgctcgg tgccgccgcc atcaccaccg       960
     acagcccgga ggggctggtc tcggactttc ggggtttcac gtacgacgac cgcggcctcg      1020
     ggaccaaact cgcccgcctg cagaccgaag gcgagttgct gcaccgcaag gccgcccggc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page