(data stored in ACNUC7421 zone)

EMBL: AP011115.PE532

AP011115.PE532       Location/Qualifiers
FT   CDS_pept        549132..549869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48779"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV2"
FT                   /protein_id="BAH48779.1"
FT                   /translation="MLHRKAARLTQLATNAEPEARTQLEAKIAVLNEHRTAAGAKRVKI
FT                   NRELGFHFARQTADYATAAGATVIAVEDLTTLETRGHGRVNNNRAAQSARRKAITALAH
FT                   TAASVGITVVSVPARGSSAQCPGCDAPLARPDGYHTAWCSGCRVGGNRDHIAGVNLAKR
FT                   ALLGKGKVTRRRGQMPAVRVAEHAPVRRSRDKTGPTPRRPRHRRVRRSLPTVTPRAGVT
FT                   PKQICSCTSSVGVGHGPTRTTSR"
     ttgctgcacc gcaaggccgc ccggctgacg caactcgcca ccaacgccga acccgaggcc        60
     cgcacccaac tcgaggcgaa gatcgccgtc ctcaacgagc atcgcactgc ggcgggcgcc       120
     aagcgcgtca agatcaaccg agagctggga ttccacttcg cccgccagac cgccgactac       180
     gccaccgcgg cgggggcgac ggtgatcgcg gtggaggatc tcaccaccct cgagacccgc       240
     ggacacggcc gagtcaacaa caaccgggcc gcgcagtccg cccgccgcaa agcgatcact       300
     gccctcgcgc acaccgccgc gagtgtcggc atcacggtgg tctcggtgcc ggcccgcgga       360
     tcctccgcgc agtgtccggg ctgcgacgca cccctcgcac gccccgacgg ctaccacacc       420
     gcgtggtgtt caggttgccg ggtcggcggc aaccgcgacc acatcgccgg agtgaacctg       480
     gccaaacgcg cactgctcgg caaaggcaag gtgacccgtc ggcgggggca gatgcccgcg       540
     gtccgggtcg ccgagcacgc gccggtccgc cggtcccggg acaaaaccgg tccgacaccg       600
     cgtcggccgc ggcaccgccg ggtccgccgc agcctgccca ccgtgacacc gcgggcgggg       660
     gtgactccga aacagatatg ttcctgcacc tcgagcgtcg gtgtgggaca cggtccaacc       720
     cgcaccacct cacggtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page