(data stored in ACNUC7421 zone)

EMBL: AP011115.PE536

AP011115.PE536       Location/Qualifiers
FT   CDS_pept        552720..553472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48783"
FT                   /db_xref="GOA:C1ARV6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV6"
FT                   /protein_id="BAH48783.1"
FT                   /translation="MADPMHFEAHAEIYGEARPPYPPALWDYLHGLGVLERGRRALDIG
FT                   AGTGQATGPLLAAGLDVTAVEPGPRLAARLRRAHPDAVVINERAEDVELPDSGFDIAIA
FT                   ATSIHWIDLDIVLPKIHRALTPDGKFLVWRNVFGDPETRTPFRERVARIVQDRGASPRV
FT                   GPDPDDVAALSEELTRSSLFSVDVVRTFRWNIELNDRQVFRLFSTFSDWTSEEADRAAA
FT                   AVRELGGTVVEHYTTWLVALTPTPATTR"
     gtggccgatc cgatgcactt cgaggcgcac gccgaaatct acggtgaggc gcggccgccg        60
     tatccaccgg ccctgtggga ctaccttcac ggtctcggtg ttctcgagcg tggccgccgt       120
     gccctggaca tcggagcggg aaccgggcag gcgaccggtc ccctgctcgc cgcgggcctg       180
     gacgtcaccg ccgtggaacc cgggcctcgc ctcgccgcac gccttcgacg tgcacatccg       240
     gacgcggtcg tcatcaacga acgcgccgag gacgtcgagc ttcccgacag tggcttcgat       300
     atcgcaatcg cggccacctc gatacattgg atcgacctcg acatagttct tccgaaaatc       360
     caccgcgcgc tgacccccga tggaaagttc ctggtgtggc ggaacgtctt cggagacccc       420
     gaaaccagga ccccgttccg ggagcgtgtc gcacggatcg tgcaggaccg cggcgcgtca       480
     ccacgcgtcg gacccgatcc ggacgatgtt gcggcgctct ccgaagagtt gactcgttcg       540
     agcctgttct ccgtcgacgt ggtccgcacg tttcgatgga acatcgaact gaacgaccgg       600
     caagttttcc ggctgttctc gacgttcagt gactggacct cggaggaggc cgaccgcgct       660
     gccgccgccg tccgggaact cggaggcacc gtggtcgagc attacacgac gtggctcgtc       720
     gcattgaccc ccactcccgc gaccacccgc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page