(data stored in ACNUC7421 zone)

EMBL: AP011115.PE538

AP011115.PE538       Location/Qualifiers
FT   CDS_pept        complement(554509..554940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48785"
FT                   /db_xref="GOA:C1ARV8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV8"
FT                   /protein_id="BAH48785.1"
FT                   /translation="MIVSDDLPPSQHYIGGEFVAGEAGSFTDIVDPATETVIARIPEGT
FT                   TADVDRAVAAAVAAKPDWARLVPRQRSEILHRIADRLEQNSEILARIESANTGKPFEVS
FT                   NDDVAGTVDTFRFMAGAFTCHHLPLRGRLRREPPLAHPP"
     ttgatcgtct ccgacgatct tccgccgtcg cagcactaca tcggcggaga attcgtcgca        60
     ggcgaggcgg gctcgttcac ggacatcgtc gaccccgcca ccgagaccgt catcgcccga       120
     atccccgaag gcaccaccgc agacgtcgac cgagccgtcg ccgccgcggt cgccgccaag       180
     ccggactggg cgcggctggt ccccagacaa cgctcggaaa tactgcaccg catcgccgac       240
     cgactcgaac agaactccga gatcctcgcc cgaatcgaat ccgccaacac cggcaaaccc       300
     ttcgaggtgt cgaacgacga cgtcgccggc accgtcgaca ccttccgatt catggcgggc       360
     gcatttacgt gccaccacct ccctctccgc gggcgactac gccgagaacc acctctcgct       420
     catcctccgt ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page