(data stored in ACNUC7421 zone)

EMBL: AP011115.PE54

AP011115.PE54        Location/Qualifiers
FT   CDS_pept        complement(44768..45133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00540"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48301"
FT                   /db_xref="GOA:C1AS52"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS52"
FT                   /protein_id="BAH48301.1"
FT                   /translation="MNGWRAAAPNCRCSFSPDGERRGAPDRCEARARQICQVCPGLVRC
FT                   RDHALTSGESYGVWGGMTESDRRKHTNRSRRGERRPLGSFQERPVGAASGVRGATFTGS
FT                   YGGAYTGGASRGRPTAR"
     gtgaatggct ggcgtgccgc ggcgccgaac tgtcggtgtt ccttctcccc cgacggtgaa        60
     cggcgcggcg ctccggatcg gtgtgaagcg cgggcccggc agatttgtca ggtgtgcccc       120
     gggctggtgc ggtgtcgcga tcacgcgctg acctcgggtg aatcctacgg cgtgtggggt       180
     ggcatgaccg agtcggaccg acgaaagcac accaaccgtt cccgccgagg tgagcgtcga       240
     ccgctcgggt ccttccagga gcgacctgtg ggtgctgcat cgggagtacg cggggccacg       300
     ttcaccggtt cgtatggcgg tgcgtacacc ggtggggcgt cgaggggtcg ccccaccgcc       360
     cggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page