(data stored in ACNUC7421 zone)

EMBL: AP011115.PE542

AP011115.PE542       Location/Qualifiers
FT   CDS_pept        complement(559359..559751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48789"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW2"
FT                   /protein_id="BAH48789.1"
FT                   /translation="MRFVAAVSDGFGKARIASLGTADAPAKRGASRRVGGSAGLAAMVE
FT                   PGALQIQERRALGICSLLPAGDVVPNGSRTSVKFRRSAVGVLVVEKMGGRAIAPNQQLF
FT                   IGETRRRSFVELRDRDVLHELQRDTQ"
     gtgcgcttcg tcgccgcagt ctctgatggg ttcggaaagg cccggatcgc gtcgctcggt        60
     accgctgacg cgccggcgaa gcgcggtgcg tcacgccggg tcggtggctc tgcggggctg       120
     gcggcgatgg tggaaccggg cgcgctgcag atccaggagc gtcgcgccct cggtatctgc       180
     tcgctgctgc cggcgggcga tgtcgtcccg aacggcagtc gtacgtcggt gaagttccgc       240
     cgctcggccg tcggcgttct cgtcgtcgag aaaatgggcg gccgcgcgat cgcaccgaat       300
     cagcaactgt tcataggcga gacgcgccgg cgctcgttcg tcgagttgcg tgatcgcgac       360
     gtcctccacg aattgcaaag ggatacgcag taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page