(data stored in ACNUC7421 zone)

EMBL: AP011115.PE543

AP011115.PE543       Location/Qualifiers
FT   CDS_pept        complement(559726..560559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48790"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW3"
FT                   /protein_id="BAH48790.1"
FT                   /translation="MGTSRLGDVELTYQLRERGERVVLVHASAFASWYDPLIEQLTAYS
FT                   TLRYRRRLRKSDSGVYRALTVAEDAGTCVSVMDHVGWDAAHIVGHSYGALVALQLATEN
FT                   PGRVGSVALLEPAIRGVASSEQIIVALQPVIAAYRSGDKAAAVDGFLRHVCGDGYRGVL
FT                   DRMVPHAFDDALEEADLFFQSELPAVQQWSFGAAESERITQPVLNVLGAESAPRFVEGS
FT                   ELLQSWFPRAERLSVPKAGHLLMVQNPTAVARGLKDFFSRHPIDQVGSALRRRSL"
     gtgggtactt cgaggctcgg cgacgtcgaa ctgacttatc agctgcgcga gcgcggtgag        60
     cgtgtcgtgc tcgtccatgc cagcgccttc gcctcgtggt atgacccgct gatcgagcag       120
     ctgacggcgt attcgaccct gcggtatcgt cggcggctcc gaaaatcgga cagtggggta       180
     taccgggcgc tcacggtcgc cgaagatgcc ggaacctgcg tcagcgtgat ggatcatgtc       240
     ggctgggacg cagcccacat cgtggggcac tcctatggtg cgcttgtcgc gctccaattg       300
     gcgacggaga atcctgggcg cgtcggctcg gtggcactgc tcgaacccgc aatccggggg       360
     gtcgccagct cggagcagat catcgttgcg ctccaaccgg tcatcgctgc ctaccgatcg       420
     ggcgacaagg cggccgcggt ggacgggttc ctgcgccatg tgtgcggcga cggctatcga       480
     ggcgtgctcg accggatggt tccacacgcc ttcgacgacg cactcgaaga ggctgacttg       540
     ttctttcaat cggagttgcc ggccgtgcag cagtggagtt tcggagcagc ggagtccgag       600
     cgcatcacgc agccggtgct caatgtgctc ggcgccgagt ccgcgccgcg gttcgtcgaa       660
     ggaagcgagc tcctgcagtc ctggttcccg cgggccgaga gactttccgt gccgaaggcc       720
     gggcaccttc tgatggtcca gaaccccacg gcagtggcgc ggggcctgaa ggatttcttc       780
     tcacgtcatc cgatcgacca ggtcgggagt gcgcttcgtc gccgcagtct ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page