(data stored in ACNUC7421 zone)

EMBL: AP011115.PE546

AP011115.PE546       Location/Qualifiers
FT   CDS_pept        complement(562381..563634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05460"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="protein synonym:reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48793"
FT                   /db_xref="GOA:C1ARW6"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW6"
FT                   /protein_id="BAH48793.1"
FT                   /translation="MTARPALSPEIARRLAAVATDGAWTRAGLVLRFEETGVPDAGRIA
FT                   IRLHDLMPTPPIGGIDSVHRLLSELPLIAPPEPIVDEVSGNDWKFDVPQWSRTAAVAEA
FT                   VGLTPTELDWFADSGGWLRTKAPPLQHYRYRIRSDNRLLEAPKERLREVQRRVLRTVLD
FT                   RVPPHVAAHGFVRGRSVHTFAAPHAGHEVVLRVDLRAFFPSVSRTRVQAVFDALGYPAR
FT                   VSRVLAGLCTTSTPPGVLAQLPFDTASRLRGAHLPQGAPTSPALANLVAHRLDRRLTGL
FT                   ARTHRVAYTRYADDLAFSGSDLAVDRLIHAVGLIVADEGFSVHPGKTRVMRAHRRQHLA
FT                   GLVVNTRPQAARAEYDAVKALLFNCVRHGPDSQNRDGRPHFREYVYGRIAWVGESNEGR
FT                   KRSLHALAARVDWTEQRL"
     atgacggccc gcccggctct gtcgcccgag atcgctcgtc gtctcgcagc ggtggcgact        60
     gacggagcct ggacgagggc cgggctcgtg ctccgcttcg aggaaaccgg agtgccggac       120
     gccggccgga tcgcgatacg gctccacgac ctcatgccca cgccaccgat cggcggcatc       180
     gacagcgtcc atcggctgct gtcggaactt ccgctgatcg caccaccgga gccgatcgtc       240
     gacgaggtgt ccggcaacga ctggaagttc gacgtcccgc agtggtcgcg cacagccgcg       300
     gtcgccgagg cggtcggcct cacccccacc gaactcgact ggttcgcgga ttccggcggg       360
     tggctgcgca cgaaggcgcc gccgctgcag cactaccgct accggatccg gtcggacaac       420
     cgcctgctcg aagcgcccaa agaacgcctc cgggaagtgc agcgccgggt cctgcggacc       480
     gttctcgacc gcgttccgcc ccacgtcgcg gcgcacggat tcgtccgagg tcgcagtgtc       540
     cacaccttcg ccgctccgca tgcggggcac gaggtcgtgc tgcgcgtcga ccttcgcgcc       600
     ttcttcccct cggtctcacg gacgcgggtg caggcggtct tcgacgcact cggctatccg       660
     gccagggtgt cacgggtgct cgctgggctc tgcaccacgt cgaccccgcc cggtgtcctc       720
     gcgcagcttc cgttcgacac ggcgagccgg ctccggggtg cacacctgcc gcagggggcg       780
     ccgacgtcgc cggctctcgc caatctcgtt gcccaccggc tcgatcgcag attgaccgga       840
     ctcgcgcgaa cccaccgcgt cgcgtacacc aggtatgccg acgatctcgc gttctccggg       900
     tcggatctgg cggtggaccg actgatccac gcagtcggtc tgatcgtggc ggacgaaggc       960
     ttttccgtcc acccgggaaa gacccgggtg atgcgagcac atcgacgcca gcacctggcc      1020
     gggctggtgg tcaacactcg tccgcaggcc gcccgcgccg agtacgacgc tgtgaaggcg      1080
     ctgctgttca attgtgttcg gcacggaccg gattcgcaga atcgggacgg cagaccgcac      1140
     tttcgcgagt acgtttacgg acgcatcgcc tgggtcgggg aatcgaacga gggcaggaaa      1200
     cgttcgctgc acgccttggc cgcccgggtc gactggacgg agcagcgtct ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page