(data stored in ACNUC7421 zone)

EMBL: AP011115.PE547

AP011115.PE547       Location/Qualifiers
FT   CDS_pept        564241..565353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48794"
FT                   /db_xref="GOA:C1ARW7"
FT                   /db_xref="InterPro:IPR031928"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW7"
FT                   /protein_id="BAH48794.1"
FT                   /translation="MRGVARGSKRKGNPDADLPGDDAPADLAAVRRDDALIDAIAGDGP
FT                   VATDSPEQYELALLLTNWRADIVSTPMPTGPLLDDVIAAIDASDNARSARSAARGKLRL
FT                   LRPIAGAAAAIAVVMGGATIFSYNAEPGDPLWSVKSVVFSQQADSTVAQIDTTTQLQEA
FT                   ERLIAAGDAESAKNLLDGAADRAGGVRDADKRNELDVWRAKLAAELEKIAPTTPPATTT
FT                   PGTTTTDTPTQTTSSPATVPGTEPLPGTQLPPDLQLPGLPPNSMPPLPTTTLPPETLPY
FT                   ISPEPTITMVPPPQAPLPEPSDNPITQPPPPEPSDNPITQPPPSEPSDNPITQPPPPEP
FT                   SDNPATQPPVEQPPPQEPSSEPLAPPVPTS"
     gtgagaggtg tggctagggg cagcaagcgc aagggcaatc ccgatgccga tctcccagga        60
     gacgacgcac cggcggacct cgcggctgtg cgccgcgacg atgcgctgat cgacgcgatc       120
     gccggtgacg gtcccgtcgc aacggactcg ccggagcagt acgagctcgc gcttctgctg       180
     accaattggc gtgccgacat cgtgtcgacg ccgatgccga ccggaccgct gctcgacgac       240
     gtgatcgcgg cgatcgacgc ctcggacaac gcccgttccg cacgcagcgc cgcccgcggc       300
     aagctccgcc tgttgcggcc catcgcaggc gctgccgccg cgatcgcggt cgtcatgggc       360
     ggtgccacca tcttctcgta caacgccgaa cccggtgatc cgctgtggag cgtcaagtcg       420
     gtcgtgttca gtcagcaggc cgattcgacg gtcgcgcaga tcgacaccac gacgcagctg       480
     caggaggccg agcggctgat cgccgcgggc gacgcggagt cggcgaagaa cctgctcgac       540
     ggcgccgccg accgtgccgg cggggtacgc gacgccgaca agcgcaacga actcgacgtg       600
     tggcgggcga agctggccgc ggaactcgag aagatcgccc ccaccacgcc accggccacg       660
     accactcccg gcaccaccac caccgacaca ccgacgcaga ccacgtcatc gccggccacc       720
     gtgccgggaa ccgagcccct gccgggaacc cagctgcccc cggatctgca gcttcccgga       780
     ctcccgccca attcaatgcc tccgctaccc acgacgacgc tcccgcccga gacgttgccg       840
     tacatcagcc ctgagcccac catcacgatg gtcccgccac cgcaagcgcc actgcctgag       900
     ccgtcggaca acccgatcac ccaaccaccg ccgcccgagc cgtcggacaa cccgatcacc       960
     caaccaccgc cgtccgagcc gtcggacaac ccgatcaccc aaccaccgcc gcccgagccg      1020
     tcggacaacc cggccacgca accacccgtt gagcagccgc cgccccagga gccgtcctcg      1080
     gagccgctcg cgccgccggt cccgaccagc tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page