(data stored in ACNUC7421 zone)

EMBL: AP011115.PE548

AP011115.PE548       Location/Qualifiers
FT   CDS_pept        565468..565740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48795"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW8"
FT                   /protein_id="BAH48795.1"
FT                   /translation="MSTPADLDEQVTKVRDALHALRRTLLDLERTYADLDANKLDVDAP
FT                   GDPTTAPETLESAVDALRAAQDTLGIADADLEVAKRHTSRLTPRG"
     gtgagcacgc ccgctgacct cgacgagcag gtaaccaagg tccgggatgc gctgcacgcc        60
     ctccgtcgaa ccctcctcga cctcgagcgc acctacgcag acctcgacgc gaacaaactc       120
     gacgtggacg cgcccggcga cccgaccacg gcaccggaga cgctggaaag cgccgtcgac       180
     gccctccgcg ccgctcagga cacgctcgga atcgctgacg ccgacctcga ggtagccaag       240
     cgacacacct cgcggttgac acctcgcggt tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page